BLASTX nr result
ID: Rehmannia30_contig00006728
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00006728 (401 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN20038.1| hypothetical protein CDL12_07274 [Handroanthus im... 155 1e-42 gb|EYU33821.1| hypothetical protein MIMGU_mgv1a027097mg, partial... 149 9e-42 emb|CDP06292.1| unnamed protein product [Coffea canephora] 144 5e-41 ref|XP_020551558.1| snRNA-activating protein complex subunit iso... 150 8e-41 ref|XP_011086302.1| snRNA-activating protein complex subunit iso... 150 8e-41 ref|XP_011086301.1| snRNA-activating protein complex subunit iso... 150 1e-40 ref|XP_011086300.1| snRNA-activating protein complex subunit iso... 150 1e-40 ref|XP_011086303.1| snRNA-activating protein complex subunit iso... 150 1e-40 ref|XP_012841923.1| PREDICTED: snRNA-activating protein complex ... 149 3e-40 ref|XP_022845227.1| snRNA-activating protein complex subunit iso... 145 6e-40 ref|XP_022845226.1| snRNA-activating protein complex subunit iso... 145 7e-40 ref|XP_022845225.1| snRNA-activating protein complex subunit iso... 145 1e-39 emb|CDP01509.1| unnamed protein product [Coffea canephora] 144 3e-38 ref|XP_009760669.1| PREDICTED: snRNA-activating protein complex ... 139 1e-37 ref|XP_010327032.1| PREDICTED: snRNA-activating protein complex ... 140 2e-37 ref|XP_019194964.1| PREDICTED: snRNA-activating protein complex ... 140 2e-37 gb|KDO78629.1| hypothetical protein CISIN_1g0136331mg, partial [... 131 2e-37 ref|XP_004248115.1| PREDICTED: snRNA-activating protein complex ... 140 3e-37 ref|XP_015089209.1| PREDICTED: snRNA-activating protein complex ... 140 3e-37 ref|XP_006361037.1| PREDICTED: snRNA-activating protein complex ... 140 3e-37 >gb|PIN20038.1| hypothetical protein CDL12_07274 [Handroanthus impetiginosus] Length = 486 Score = 155 bits (393), Expect = 1e-42 Identities = 67/77 (87%), Positives = 75/77 (97%) Frame = +2 Query: 170 GNCKHIIVIRDMRLIHPEDVQSRAAYPLVTVQTKHRYKKCSVCKIYRAEKMTVDDKWASS 349 G+CKH+IVIRD+RLIHPEDVQ+RAAYPL+T QTK RY+KCSVCKIYRAEKMTVDDKWA+S Sbjct: 394 GDCKHVIVIRDLRLIHPEDVQNRAAYPLITFQTKLRYRKCSVCKIYRAEKMTVDDKWAAS 453 Query: 350 NPCYFCDVCYYMLHYAD 400 NPCYFCDVCYYMLHYA+ Sbjct: 454 NPCYFCDVCYYMLHYAN 470 >gb|EYU33821.1| hypothetical protein MIMGU_mgv1a027097mg, partial [Erythranthe guttata] Length = 302 Score = 149 bits (376), Expect = 9e-42 Identities = 64/77 (83%), Positives = 71/77 (92%) Frame = +2 Query: 170 GNCKHIIVIRDMRLIHPEDVQSRAAYPLVTVQTKHRYKKCSVCKIYRAEKMTVDDKWASS 349 G+CKH+IVIRDMRLIHPED+QSR AYPL+T Q K +KKCSVCKIY+AEKMTVDDKWA S Sbjct: 210 GDCKHVIVIRDMRLIHPEDIQSRDAYPLITYQAKFLHKKCSVCKIYKAEKMTVDDKWAPS 269 Query: 350 NPCYFCDVCYYMLHYAD 400 NPCYFC+VCYYMLHYAD Sbjct: 270 NPCYFCEVCYYMLHYAD 286 >emb|CDP06292.1| unnamed protein product [Coffea canephora] Length = 198 Score = 144 bits (363), Expect = 5e-41 Identities = 60/77 (77%), Positives = 72/77 (93%) Frame = +2 Query: 170 GNCKHIIVIRDMRLIHPEDVQSRAAYPLVTVQTKHRYKKCSVCKIYRAEKMTVDDKWASS 349 G+CKH+IVIRDMRLIHPEDVQSRA+YPL+T Q+K R++KCS+CKIY+A K+TVDDKWA Sbjct: 106 GDCKHLIVIRDMRLIHPEDVQSRASYPLITFQSKLRFRKCSICKIYKATKVTVDDKWALE 165 Query: 350 NPCYFCDVCYYMLHYAD 400 NPCYFCD+CYYMLHYA+ Sbjct: 166 NPCYFCDLCYYMLHYAN 182 >ref|XP_020551558.1| snRNA-activating protein complex subunit isoform X5 [Sesamum indicum] Length = 453 Score = 150 bits (379), Expect = 8e-41 Identities = 65/77 (84%), Positives = 73/77 (94%) Frame = +2 Query: 170 GNCKHIIVIRDMRLIHPEDVQSRAAYPLVTVQTKHRYKKCSVCKIYRAEKMTVDDKWASS 349 G+CKHIIVIRD+RLIHPEDVQ+RAAYP++T+Q K RY+KCSVCKIYRA KMTVDDKWA S Sbjct: 361 GDCKHIIVIRDLRLIHPEDVQNRAAYPILTLQQKFRYRKCSVCKIYRAAKMTVDDKWALS 420 Query: 350 NPCYFCDVCYYMLHYAD 400 NPCYFCDVCYYMLHYA+ Sbjct: 421 NPCYFCDVCYYMLHYAN 437 >ref|XP_011086302.1| snRNA-activating protein complex subunit isoform X4 [Sesamum indicum] Length = 454 Score = 150 bits (379), Expect = 8e-41 Identities = 65/77 (84%), Positives = 73/77 (94%) Frame = +2 Query: 170 GNCKHIIVIRDMRLIHPEDVQSRAAYPLVTVQTKHRYKKCSVCKIYRAEKMTVDDKWASS 349 G+CKHIIVIRD+RLIHPEDVQ+RAAYP++T+Q K RY+KCSVCKIYRA KMTVDDKWA S Sbjct: 362 GDCKHIIVIRDLRLIHPEDVQNRAAYPILTLQQKFRYRKCSVCKIYRAAKMTVDDKWALS 421 Query: 350 NPCYFCDVCYYMLHYAD 400 NPCYFCDVCYYMLHYA+ Sbjct: 422 NPCYFCDVCYYMLHYAN 438 >ref|XP_011086301.1| snRNA-activating protein complex subunit isoform X2 [Sesamum indicum] Length = 485 Score = 150 bits (379), Expect = 1e-40 Identities = 65/77 (84%), Positives = 73/77 (94%) Frame = +2 Query: 170 GNCKHIIVIRDMRLIHPEDVQSRAAYPLVTVQTKHRYKKCSVCKIYRAEKMTVDDKWASS 349 G+CKHIIVIRD+RLIHPEDVQ+RAAYP++T+Q K RY+KCSVCKIYRA KMTVDDKWA S Sbjct: 393 GDCKHIIVIRDLRLIHPEDVQNRAAYPILTLQQKFRYRKCSVCKIYRAAKMTVDDKWALS 452 Query: 350 NPCYFCDVCYYMLHYAD 400 NPCYFCDVCYYMLHYA+ Sbjct: 453 NPCYFCDVCYYMLHYAN 469 >ref|XP_011086300.1| snRNA-activating protein complex subunit isoform X3 [Sesamum indicum] Length = 485 Score = 150 bits (379), Expect = 1e-40 Identities = 65/77 (84%), Positives = 73/77 (94%) Frame = +2 Query: 170 GNCKHIIVIRDMRLIHPEDVQSRAAYPLVTVQTKHRYKKCSVCKIYRAEKMTVDDKWASS 349 G+CKHIIVIRD+RLIHPEDVQ+RAAYP++T+Q K RY+KCSVCKIYRA KMTVDDKWA S Sbjct: 393 GDCKHIIVIRDLRLIHPEDVQNRAAYPILTLQQKFRYRKCSVCKIYRAAKMTVDDKWALS 452 Query: 350 NPCYFCDVCYYMLHYAD 400 NPCYFCDVCYYMLHYA+ Sbjct: 453 NPCYFCDVCYYMLHYAN 469 >ref|XP_011086303.1| snRNA-activating protein complex subunit isoform X1 [Sesamum indicum] ref|XP_020551557.1| snRNA-activating protein complex subunit isoform X1 [Sesamum indicum] Length = 486 Score = 150 bits (379), Expect = 1e-40 Identities = 65/77 (84%), Positives = 73/77 (94%) Frame = +2 Query: 170 GNCKHIIVIRDMRLIHPEDVQSRAAYPLVTVQTKHRYKKCSVCKIYRAEKMTVDDKWASS 349 G+CKHIIVIRD+RLIHPEDVQ+RAAYP++T+Q K RY+KCSVCKIYRA KMTVDDKWA S Sbjct: 394 GDCKHIIVIRDLRLIHPEDVQNRAAYPILTLQQKFRYRKCSVCKIYRAAKMTVDDKWALS 453 Query: 350 NPCYFCDVCYYMLHYAD 400 NPCYFCDVCYYMLHYA+ Sbjct: 454 NPCYFCDVCYYMLHYAN 470 >ref|XP_012841923.1| PREDICTED: snRNA-activating protein complex subunit [Erythranthe guttata] ref|XP_012841924.1| PREDICTED: snRNA-activating protein complex subunit [Erythranthe guttata] Length = 475 Score = 149 bits (376), Expect = 3e-40 Identities = 64/77 (83%), Positives = 71/77 (92%) Frame = +2 Query: 170 GNCKHIIVIRDMRLIHPEDVQSRAAYPLVTVQTKHRYKKCSVCKIYRAEKMTVDDKWASS 349 G+CKH+IVIRDMRLIHPED+QSR AYPL+T Q K +KKCSVCKIY+AEKMTVDDKWA S Sbjct: 383 GDCKHVIVIRDMRLIHPEDIQSRDAYPLITYQAKFLHKKCSVCKIYKAEKMTVDDKWAPS 442 Query: 350 NPCYFCDVCYYMLHYAD 400 NPCYFC+VCYYMLHYAD Sbjct: 443 NPCYFCEVCYYMLHYAD 459 >ref|XP_022845227.1| snRNA-activating protein complex subunit isoform X3 [Olea europaea var. sylvestris] Length = 348 Score = 145 bits (367), Expect = 6e-40 Identities = 62/75 (82%), Positives = 69/75 (92%) Frame = +2 Query: 170 GNCKHIIVIRDMRLIHPEDVQSRAAYPLVTVQTKHRYKKCSVCKIYRAEKMTVDDKWASS 349 G+CKH+IV+RDMRLIHPEDVQ+RAAYPLVT Q K RY+KCS CKIYRAEK+TVDDKWA Sbjct: 256 GDCKHLIVLRDMRLIHPEDVQNRAAYPLVTFQFKLRYRKCSACKIYRAEKVTVDDKWAPE 315 Query: 350 NPCYFCDVCYYMLHY 394 NPCYFCD+CYYMLHY Sbjct: 316 NPCYFCDICYYMLHY 330 >ref|XP_022845226.1| snRNA-activating protein complex subunit isoform X2 [Olea europaea var. sylvestris] Length = 357 Score = 145 bits (367), Expect = 7e-40 Identities = 62/75 (82%), Positives = 69/75 (92%) Frame = +2 Query: 170 GNCKHIIVIRDMRLIHPEDVQSRAAYPLVTVQTKHRYKKCSVCKIYRAEKMTVDDKWASS 349 G+CKH+IV+RDMRLIHPEDVQ+RAAYPLVT Q K RY+KCS CKIYRAEK+TVDDKWA Sbjct: 265 GDCKHLIVLRDMRLIHPEDVQNRAAYPLVTFQFKLRYRKCSACKIYRAEKVTVDDKWAPE 324 Query: 350 NPCYFCDVCYYMLHY 394 NPCYFCD+CYYMLHY Sbjct: 325 NPCYFCDICYYMLHY 339 >ref|XP_022845225.1| snRNA-activating protein complex subunit isoform X1 [Olea europaea var. sylvestris] Length = 378 Score = 145 bits (367), Expect = 1e-39 Identities = 62/75 (82%), Positives = 69/75 (92%) Frame = +2 Query: 170 GNCKHIIVIRDMRLIHPEDVQSRAAYPLVTVQTKHRYKKCSVCKIYRAEKMTVDDKWASS 349 G+CKH+IV+RDMRLIHPEDVQ+RAAYPLVT Q K RY+KCS CKIYRAEK+TVDDKWA Sbjct: 286 GDCKHLIVLRDMRLIHPEDVQNRAAYPLVTFQFKLRYRKCSACKIYRAEKVTVDDKWAPE 345 Query: 350 NPCYFCDVCYYMLHY 394 NPCYFCD+CYYMLHY Sbjct: 346 NPCYFCDICYYMLHY 360 >emb|CDP01509.1| unnamed protein product [Coffea canephora] Length = 467 Score = 144 bits (362), Expect = 3e-38 Identities = 60/77 (77%), Positives = 71/77 (92%) Frame = +2 Query: 170 GNCKHIIVIRDMRLIHPEDVQSRAAYPLVTVQTKHRYKKCSVCKIYRAEKMTVDDKWASS 349 G+CKH+IVIRDMRLIHPEDVQ+RAAYPL+T Q+K R++KCSVC IY+A K+TVDDKWA Sbjct: 375 GDCKHLIVIRDMRLIHPEDVQNRAAYPLITFQSKVRFRKCSVCNIYKATKVTVDDKWAQE 434 Query: 350 NPCYFCDVCYYMLHYAD 400 NPCYFC++CYYMLHYAD Sbjct: 435 NPCYFCELCYYMLHYAD 451 >ref|XP_009760669.1| PREDICTED: snRNA-activating protein complex subunit-like, partial [Nicotiana sylvestris] Length = 301 Score = 139 bits (349), Expect = 1e-37 Identities = 58/77 (75%), Positives = 70/77 (90%) Frame = +2 Query: 170 GNCKHIIVIRDMRLIHPEDVQSRAAYPLVTVQTKHRYKKCSVCKIYRAEKMTVDDKWASS 349 G+CKH +VIRDMRLIHPEDVQ+RAAYPL+T Q K R++KCSVCKI++A K+TVDDKWA+ Sbjct: 209 GDCKHQVVIRDMRLIHPEDVQNRAAYPLITFQPKLRFQKCSVCKIFKAVKVTVDDKWAAE 268 Query: 350 NPCYFCDVCYYMLHYAD 400 NPCYFCD+CYYMLHY + Sbjct: 269 NPCYFCDLCYYMLHYVN 285 >ref|XP_010327032.1| PREDICTED: snRNA-activating protein complex subunit isoform X2 [Solanum lycopersicum] Length = 396 Score = 140 bits (353), Expect = 2e-37 Identities = 57/77 (74%), Positives = 71/77 (92%) Frame = +2 Query: 170 GNCKHIIVIRDMRLIHPEDVQSRAAYPLVTVQTKHRYKKCSVCKIYRAEKMTVDDKWASS 349 G+CKH++VIRDMR+IHPEDVQ+RAAYPL+T Q K R++KCSVCKI++A K+TVDDKWA+ Sbjct: 304 GDCKHLVVIRDMRMIHPEDVQNRAAYPLITFQPKLRFQKCSVCKIFKAVKVTVDDKWAAE 363 Query: 350 NPCYFCDVCYYMLHYAD 400 NPCYFC++CYYMLHY D Sbjct: 364 NPCYFCELCYYMLHYVD 380 >ref|XP_019194964.1| PREDICTED: snRNA-activating protein complex subunit isoform X2 [Ipomoea nil] Length = 383 Score = 140 bits (352), Expect = 2e-37 Identities = 60/77 (77%), Positives = 69/77 (89%) Frame = +2 Query: 170 GNCKHIIVIRDMRLIHPEDVQSRAAYPLVTVQTKHRYKKCSVCKIYRAEKMTVDDKWASS 349 G+CKH+IVIRDMRLIHPEDVQ++AAYPLV Q + R +KCSVCKIY+AEKMTVDDKWA Sbjct: 291 GDCKHLIVIRDMRLIHPEDVQNQAAYPLVIFQLRVRLQKCSVCKIYKAEKMTVDDKWAPE 350 Query: 350 NPCYFCDVCYYMLHYAD 400 NPCYFCD+CYYMLHY + Sbjct: 351 NPCYFCDLCYYMLHYVN 367 >gb|KDO78629.1| hypothetical protein CISIN_1g0136331mg, partial [Citrus sinensis] gb|KDO78630.1| hypothetical protein CISIN_1g0136331mg, partial [Citrus sinensis] Length = 80 Score = 131 bits (329), Expect = 2e-37 Identities = 58/77 (75%), Positives = 63/77 (81%) Frame = +2 Query: 170 GNCKHIIVIRDMRLIHPEDVQSRAAYPLVTVQTKHRYKKCSVCKIYRAEKMTVDDKWASS 349 G+CKH IVIRDMRLIHPEDV SRAAYP+VT Q K R +KCSVCKIY A K+TVDDKWA Sbjct: 1 GDCKHTIVIRDMRLIHPEDVHSRAAYPIVTFQLKQRSQKCSVCKIYMAAKVTVDDKWAQD 60 Query: 350 NPCYFCDVCYYMLHYAD 400 NPCYFCD CY +LH D Sbjct: 61 NPCYFCDYCYSLLHSKD 77 >ref|XP_004248115.1| PREDICTED: snRNA-activating protein complex subunit isoform X1 [Solanum lycopersicum] ref|XP_010327030.1| PREDICTED: snRNA-activating protein complex subunit isoform X1 [Solanum lycopersicum] ref|XP_010327031.1| PREDICTED: snRNA-activating protein complex subunit isoform X1 [Solanum lycopersicum] Length = 428 Score = 140 bits (353), Expect = 3e-37 Identities = 57/77 (74%), Positives = 71/77 (92%) Frame = +2 Query: 170 GNCKHIIVIRDMRLIHPEDVQSRAAYPLVTVQTKHRYKKCSVCKIYRAEKMTVDDKWASS 349 G+CKH++VIRDMR+IHPEDVQ+RAAYPL+T Q K R++KCSVCKI++A K+TVDDKWA+ Sbjct: 336 GDCKHLVVIRDMRMIHPEDVQNRAAYPLITFQPKLRFQKCSVCKIFKAVKVTVDDKWAAE 395 Query: 350 NPCYFCDVCYYMLHYAD 400 NPCYFC++CYYMLHY D Sbjct: 396 NPCYFCELCYYMLHYVD 412 >ref|XP_015089209.1| PREDICTED: snRNA-activating protein complex subunit [Solanum pennellii] Length = 429 Score = 140 bits (353), Expect = 3e-37 Identities = 57/77 (74%), Positives = 71/77 (92%) Frame = +2 Query: 170 GNCKHIIVIRDMRLIHPEDVQSRAAYPLVTVQTKHRYKKCSVCKIYRAEKMTVDDKWASS 349 G+CKH++VIRDMR+IHPEDVQ+RAAYPL+T Q K R++KCSVCKI++A K+TVDDKWA+ Sbjct: 337 GDCKHLVVIRDMRMIHPEDVQNRAAYPLITFQPKLRFQKCSVCKIFKAVKVTVDDKWAAE 396 Query: 350 NPCYFCDVCYYMLHYAD 400 NPCYFC++CYYMLHY D Sbjct: 397 NPCYFCELCYYMLHYVD 413 >ref|XP_006361037.1| PREDICTED: snRNA-activating protein complex subunit [Solanum tuberosum] ref|XP_015170586.1| PREDICTED: snRNA-activating protein complex subunit [Solanum tuberosum] Length = 429 Score = 140 bits (353), Expect = 3e-37 Identities = 57/77 (74%), Positives = 71/77 (92%) Frame = +2 Query: 170 GNCKHIIVIRDMRLIHPEDVQSRAAYPLVTVQTKHRYKKCSVCKIYRAEKMTVDDKWASS 349 G+CKH++VIRDMR+IHPEDVQ+RAAYPL+T Q K R++KCSVCKI++A K+TVDDKWA+ Sbjct: 337 GDCKHLVVIRDMRMIHPEDVQNRAAYPLITFQPKLRFQKCSVCKIFKAVKVTVDDKWAAE 396 Query: 350 NPCYFCDVCYYMLHYAD 400 NPCYFC++CYYMLHY D Sbjct: 397 NPCYFCELCYYMLHYVD 413