BLASTX nr result
ID: Rehmannia30_contig00005166
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00005166 (533 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN20066.1| hypothetical protein CDL12_07227 [Handroanthus im... 56 3e-06 >gb|PIN20066.1| hypothetical protein CDL12_07227 [Handroanthus impetiginosus] Length = 213 Score = 55.8 bits (133), Expect = 3e-06 Identities = 23/44 (52%), Positives = 33/44 (75%) Frame = -3 Query: 138 NNSSKHGVPENVQPEVAITENPKEQPDHLASIQKVHTLRKNEVP 7 ++SSKHGVPE+++ ++ +TENP+EQPD SIQ VH + E P Sbjct: 3 SSSSKHGVPEDIRSDIGMTENPREQPDPSVSIQNVHEVWNKEAP 46