BLASTX nr result
ID: Rehmannia30_contig00004261
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00004261 (773 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN22436.1| BCL2-associated athanogene-like protein [Handroan... 62 2e-07 >gb|PIN22436.1| BCL2-associated athanogene-like protein [Handroanthus impetiginosus] Length = 257 Score = 61.6 bits (148), Expect = 2e-07 Identities = 26/34 (76%), Positives = 31/34 (91%) Frame = +3 Query: 3 LKVSNAKQKVPLVMSTKWETFDHSPASTHWELFD 104 LK+SNAK+KVP+V++TKWETFD SP ST WELFD Sbjct: 224 LKISNAKEKVPVVVTTKWETFDPSPPSTQWELFD 257