BLASTX nr result
ID: Rehmannia30_contig00004248
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00004248 (483 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN15124.1| hypothetical protein CDL12_12233 [Handroanthus im... 73 7e-13 gb|PIN26921.1| hypothetical protein CDL12_00325 [Handroanthus im... 71 5e-12 >gb|PIN15124.1| hypothetical protein CDL12_12233 [Handroanthus impetiginosus] Length = 207 Score = 73.2 bits (178), Expect = 7e-13 Identities = 36/42 (85%), Positives = 40/42 (95%), Gaps = 1/42 (2%) Frame = +1 Query: 1 TGEYLMARGIALKKTLVMDPDTLNSIMEYTMYVYSN-PMGIS 123 TG+YLMARGIALK+TLVMDPDTLNSIMEYTMYVYS+ P G+S Sbjct: 164 TGKYLMARGIALKRTLVMDPDTLNSIMEYTMYVYSSGPTGLS 205 >gb|PIN26921.1| hypothetical protein CDL12_00325 [Handroanthus impetiginosus] Length = 207 Score = 70.9 bits (172), Expect = 5e-12 Identities = 33/36 (91%), Positives = 36/36 (100%) Frame = +1 Query: 1 TGEYLMARGIALKKTLVMDPDTLNSIMEYTMYVYSN 108 TG+YLMARGIALK+TLVMDPDTLNSIMEYTMYVYS+ Sbjct: 164 TGKYLMARGIALKRTLVMDPDTLNSIMEYTMYVYSS 199