BLASTX nr result
ID: Rehmannia30_contig00004049
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00004049 (419 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011086855.1| EKC/KEOPS complex subunit bud32 [Sesamum ind... 154 2e-44 gb|PIN19478.1| Serine/threonine protein kinase [Handroanthus imp... 150 4e-43 ref|XP_022154600.1| EKC/KEOPS complex subunit bud32 [Momordica c... 145 7e-41 ref|XP_012833234.1| PREDICTED: EKC/KEOPS complex subunit bud32-l... 145 7e-41 ref|XP_022971412.1| EKC/KEOPS complex subunit bud32 isoform X2 [... 143 2e-40 ref|XP_019238290.1| PREDICTED: EKC/KEOPS complex subunit bud32-l... 144 2e-40 ref|XP_023529406.1| EKC/KEOPS complex subunit bud32 [Cucurbita p... 143 3e-40 ref|XP_022971395.1| EKC/KEOPS complex subunit bud32 isoform X1 [... 143 3e-40 ref|XP_019238291.1| PREDICTED: EKC/KEOPS complex subunit bud32-l... 143 3e-40 ref|XP_009612523.1| PREDICTED: EKC/KEOPS complex subunit bud32-l... 143 3e-40 ref|XP_019238287.1| PREDICTED: TP53-regulating kinase-like isofo... 144 5e-40 ref|XP_022924768.1| EKC/KEOPS complex subunit bud32 [Cucurbita m... 142 8e-40 ref|XP_021653911.1| TP53-regulating kinase isoform X1 [Hevea bra... 142 8e-40 gb|EPS70566.1| hypothetical protein M569_04196, partial [Genlise... 141 8e-40 ref|XP_021821949.1| EKC/KEOPS complex subunit bud32 [Prunus aviu... 142 9e-40 ref|XP_008235382.1| PREDICTED: EKC/KEOPS complex subunit bud32 [... 142 9e-40 gb|OVA15526.1| Protein kinase domain [Macleaya cordata] 142 1e-39 ref|XP_009760169.1| PREDICTED: EKC/KEOPS complex subunit bud32-l... 141 2e-39 ref|XP_009760168.1| PREDICTED: EKC/KEOPS complex subunit bud32-l... 142 2e-39 gb|KDO68667.1| hypothetical protein CISIN_1g027265mg [Citrus sin... 138 4e-39 >ref|XP_011086855.1| EKC/KEOPS complex subunit bud32 [Sesamum indicum] ref|XP_011086856.1| EKC/KEOPS complex subunit bud32 [Sesamum indicum] ref|XP_011086857.1| EKC/KEOPS complex subunit bud32 [Sesamum indicum] Length = 226 Score = 154 bits (388), Expect = 2e-44 Identities = 78/80 (97%), Positives = 80/80 (100%) Frame = -2 Query: 241 MEIKLDGVEGSMVLIKQGAEARVFESTFVGRRSIVKERFSKKYRHPSLDSKLTLKRLNAE 62 MEIKLDGVEGS+VLIKQGAEARVFESTFVGRRSIVKERFSKKYRHPSLDSKLT+KRLNAE Sbjct: 1 MEIKLDGVEGSLVLIKQGAEARVFESTFVGRRSIVKERFSKKYRHPSLDSKLTVKRLNAE 60 Query: 61 ARCMTKARKLGVSTPVLYAV 2 ARCMTKARKLGVSTPVLYAV Sbjct: 61 ARCMTKARKLGVSTPVLYAV 80 >gb|PIN19478.1| Serine/threonine protein kinase [Handroanthus impetiginosus] Length = 226 Score = 150 bits (380), Expect = 4e-43 Identities = 76/80 (95%), Positives = 79/80 (98%) Frame = -2 Query: 241 MEIKLDGVEGSMVLIKQGAEARVFESTFVGRRSIVKERFSKKYRHPSLDSKLTLKRLNAE 62 MEIKLDGVE S++LIKQGAEARVFESTFVGRRSIVKERFSKKYRHPSLD+KLTLKRLNAE Sbjct: 1 MEIKLDGVEDSLILIKQGAEARVFESTFVGRRSIVKERFSKKYRHPSLDAKLTLKRLNAE 60 Query: 61 ARCMTKARKLGVSTPVLYAV 2 ARCMTKARKLGVSTPVLYAV Sbjct: 61 ARCMTKARKLGVSTPVLYAV 80 >ref|XP_022154600.1| EKC/KEOPS complex subunit bud32 [Momordica charantia] ref|XP_022154601.1| EKC/KEOPS complex subunit bud32 [Momordica charantia] Length = 226 Score = 145 bits (365), Expect = 7e-41 Identities = 72/80 (90%), Positives = 77/80 (96%) Frame = -2 Query: 241 MEIKLDGVEGSMVLIKQGAEARVFESTFVGRRSIVKERFSKKYRHPSLDSKLTLKRLNAE 62 MEIK D +GS++LIKQGAEARVFESTFVGRRSI+KERFSKKYRHPSLDSKLTLKRLNAE Sbjct: 1 MEIKTDSNDGSLILIKQGAEARVFESTFVGRRSIIKERFSKKYRHPSLDSKLTLKRLNAE 60 Query: 61 ARCMTKARKLGVSTPVLYAV 2 ARCMTKAR+LGVSTPVLYAV Sbjct: 61 ARCMTKARRLGVSTPVLYAV 80 >ref|XP_012833234.1| PREDICTED: EKC/KEOPS complex subunit bud32-like [Erythranthe guttata] gb|EYU40902.1| hypothetical protein MIMGU_mgv1a013249mg [Erythranthe guttata] Length = 226 Score = 145 bits (365), Expect = 7e-41 Identities = 72/80 (90%), Positives = 78/80 (97%) Frame = -2 Query: 241 MEIKLDGVEGSMVLIKQGAEARVFESTFVGRRSIVKERFSKKYRHPSLDSKLTLKRLNAE 62 ME+KLDG EGS+VLIKQGAEARVFESTFVG+RS+VKERFSKKYRHPSLD+KLT+KRLNAE Sbjct: 1 MEMKLDGEEGSVVLIKQGAEARVFESTFVGKRSVVKERFSKKYRHPSLDTKLTVKRLNAE 60 Query: 61 ARCMTKARKLGVSTPVLYAV 2 ARCMTKARKLGV TPVLYAV Sbjct: 61 ARCMTKARKLGVLTPVLYAV 80 >ref|XP_022971412.1| EKC/KEOPS complex subunit bud32 isoform X2 [Cucurbita maxima] Length = 215 Score = 143 bits (361), Expect = 2e-40 Identities = 73/80 (91%), Positives = 76/80 (95%) Frame = -2 Query: 241 MEIKLDGVEGSMVLIKQGAEARVFESTFVGRRSIVKERFSKKYRHPSLDSKLTLKRLNAE 62 MEIK D +GS+VLIKQGAEARVFESTFVGRRSIVKERFSKKYRHPSLDSKLTLKRLNAE Sbjct: 1 MEIKTDSNDGSLVLIKQGAEARVFESTFVGRRSIVKERFSKKYRHPSLDSKLTLKRLNAE 60 Query: 61 ARCMTKARKLGVSTPVLYAV 2 ARCMTKAR+L VSTPVLYAV Sbjct: 61 ARCMTKARRLAVSTPVLYAV 80 >ref|XP_019238290.1| PREDICTED: EKC/KEOPS complex subunit bud32-like isoform X2 [Nicotiana attenuata] Length = 233 Score = 144 bits (362), Expect = 2e-40 Identities = 72/83 (86%), Positives = 78/83 (93%) Frame = -2 Query: 250 LFTMEIKLDGVEGSMVLIKQGAEARVFESTFVGRRSIVKERFSKKYRHPSLDSKLTLKRL 71 L MEIK DG +GS+VLIKQGAEARVFESTFVGRR IVKERFSKKYRHP+LDSKLT+KRL Sbjct: 5 LTEMEIKADGSDGSLVLIKQGAEARVFESTFVGRRCIVKERFSKKYRHPTLDSKLTIKRL 64 Query: 70 NAEARCMTKARKLGVSTPVLYAV 2 NAEARCMTKAR+LGV+TPVLYAV Sbjct: 65 NAEARCMTKARRLGVATPVLYAV 87 >ref|XP_023529406.1| EKC/KEOPS complex subunit bud32 [Cucurbita pepo subsp. pepo] ref|XP_023529407.1| EKC/KEOPS complex subunit bud32 [Cucurbita pepo subsp. pepo] Length = 226 Score = 143 bits (361), Expect = 3e-40 Identities = 73/80 (91%), Positives = 76/80 (95%) Frame = -2 Query: 241 MEIKLDGVEGSMVLIKQGAEARVFESTFVGRRSIVKERFSKKYRHPSLDSKLTLKRLNAE 62 MEIK D +GS+VLIKQGAEARVFESTFVGRRSIVKERFSKKYRHPSLDSKLTLKRLNAE Sbjct: 1 MEIKTDSNDGSLVLIKQGAEARVFESTFVGRRSIVKERFSKKYRHPSLDSKLTLKRLNAE 60 Query: 61 ARCMTKARKLGVSTPVLYAV 2 ARCMTKAR+L VSTPVLYAV Sbjct: 61 ARCMTKARRLAVSTPVLYAV 80 >ref|XP_022971395.1| EKC/KEOPS complex subunit bud32 isoform X1 [Cucurbita maxima] ref|XP_022971403.1| EKC/KEOPS complex subunit bud32 isoform X1 [Cucurbita maxima] Length = 226 Score = 143 bits (361), Expect = 3e-40 Identities = 73/80 (91%), Positives = 76/80 (95%) Frame = -2 Query: 241 MEIKLDGVEGSMVLIKQGAEARVFESTFVGRRSIVKERFSKKYRHPSLDSKLTLKRLNAE 62 MEIK D +GS+VLIKQGAEARVFESTFVGRRSIVKERFSKKYRHPSLDSKLTLKRLNAE Sbjct: 1 MEIKTDSNDGSLVLIKQGAEARVFESTFVGRRSIVKERFSKKYRHPSLDSKLTLKRLNAE 60 Query: 61 ARCMTKARKLGVSTPVLYAV 2 ARCMTKAR+L VSTPVLYAV Sbjct: 61 ARCMTKARRLAVSTPVLYAV 80 >ref|XP_019238291.1| PREDICTED: EKC/KEOPS complex subunit bud32-like isoform X3 [Nicotiana attenuata] ref|XP_019238292.1| PREDICTED: EKC/KEOPS complex subunit bud32-like isoform X3 [Nicotiana attenuata] Length = 226 Score = 143 bits (361), Expect = 3e-40 Identities = 71/80 (88%), Positives = 77/80 (96%) Frame = -2 Query: 241 MEIKLDGVEGSMVLIKQGAEARVFESTFVGRRSIVKERFSKKYRHPSLDSKLTLKRLNAE 62 MEIK DG +GS+VLIKQGAEARVFESTFVGRR IVKERFSKKYRHP+LDSKLT+KRLNAE Sbjct: 1 MEIKADGSDGSLVLIKQGAEARVFESTFVGRRCIVKERFSKKYRHPTLDSKLTIKRLNAE 60 Query: 61 ARCMTKARKLGVSTPVLYAV 2 ARCMTKAR+LGV+TPVLYAV Sbjct: 61 ARCMTKARRLGVATPVLYAV 80 >ref|XP_009612523.1| PREDICTED: EKC/KEOPS complex subunit bud32-like [Nicotiana tomentosiformis] ref|XP_009612524.1| PREDICTED: EKC/KEOPS complex subunit bud32-like [Nicotiana tomentosiformis] ref|XP_009612525.1| PREDICTED: EKC/KEOPS complex subunit bud32-like [Nicotiana tomentosiformis] ref|XP_016462849.1| PREDICTED: EKC/KEOPS complex subunit bud32-like isoform X1 [Nicotiana tabacum] ref|XP_016462857.1| PREDICTED: EKC/KEOPS complex subunit bud32-like isoform X1 [Nicotiana tabacum] ref|XP_016462862.1| PREDICTED: EKC/KEOPS complex subunit bud32-like isoform X1 [Nicotiana tabacum] ref|XP_016462867.1| PREDICTED: EKC/KEOPS complex subunit bud32-like isoform X1 [Nicotiana tabacum] ref|XP_018629545.1| PREDICTED: EKC/KEOPS complex subunit bud32-like [Nicotiana tomentosiformis] Length = 226 Score = 143 bits (361), Expect = 3e-40 Identities = 71/80 (88%), Positives = 77/80 (96%) Frame = -2 Query: 241 MEIKLDGVEGSMVLIKQGAEARVFESTFVGRRSIVKERFSKKYRHPSLDSKLTLKRLNAE 62 MEIK DG +GS+VLIKQGAEARVFESTF+GRR IVKERFSKKYRHP+LDSKLTLKRLNAE Sbjct: 1 MEIKADGCDGSLVLIKQGAEARVFESTFLGRRCIVKERFSKKYRHPTLDSKLTLKRLNAE 60 Query: 61 ARCMTKARKLGVSTPVLYAV 2 ARCMTKAR+LGV+TPVLYAV Sbjct: 61 ARCMTKARRLGVTTPVLYAV 80 >ref|XP_019238287.1| PREDICTED: TP53-regulating kinase-like isoform X1 [Nicotiana attenuata] ref|XP_019238288.1| PREDICTED: TP53-regulating kinase-like isoform X1 [Nicotiana attenuata] gb|OIT21833.1| hypothetical protein A4A49_32859 [Nicotiana attenuata] Length = 259 Score = 144 bits (362), Expect = 5e-40 Identities = 72/83 (86%), Positives = 78/83 (93%) Frame = -2 Query: 250 LFTMEIKLDGVEGSMVLIKQGAEARVFESTFVGRRSIVKERFSKKYRHPSLDSKLTLKRL 71 L MEIK DG +GS+VLIKQGAEARVFESTFVGRR IVKERFSKKYRHP+LDSKLT+KRL Sbjct: 31 LTEMEIKADGSDGSLVLIKQGAEARVFESTFVGRRCIVKERFSKKYRHPTLDSKLTIKRL 90 Query: 70 NAEARCMTKARKLGVSTPVLYAV 2 NAEARCMTKAR+LGV+TPVLYAV Sbjct: 91 NAEARCMTKARRLGVATPVLYAV 113 >ref|XP_022924768.1| EKC/KEOPS complex subunit bud32 [Cucurbita moschata] ref|XP_022924777.1| EKC/KEOPS complex subunit bud32 [Cucurbita moschata] ref|XP_022924786.1| EKC/KEOPS complex subunit bud32 [Cucurbita moschata] ref|XP_022924793.1| EKC/KEOPS complex subunit bud32 [Cucurbita moschata] Length = 226 Score = 142 bits (358), Expect = 8e-40 Identities = 72/80 (90%), Positives = 75/80 (93%) Frame = -2 Query: 241 MEIKLDGVEGSMVLIKQGAEARVFESTFVGRRSIVKERFSKKYRHPSLDSKLTLKRLNAE 62 ME K D +GS+VLIKQGAEARVFESTFVGRRSIVKERFSKKYRHPSLDSKLTLKRLNAE Sbjct: 1 METKTDSYDGSLVLIKQGAEARVFESTFVGRRSIVKERFSKKYRHPSLDSKLTLKRLNAE 60 Query: 61 ARCMTKARKLGVSTPVLYAV 2 ARCMTKAR+L VSTPVLYAV Sbjct: 61 ARCMTKARRLAVSTPVLYAV 80 >ref|XP_021653911.1| TP53-regulating kinase isoform X1 [Hevea brasiliensis] Length = 226 Score = 142 bits (358), Expect = 8e-40 Identities = 72/80 (90%), Positives = 76/80 (95%) Frame = -2 Query: 241 MEIKLDGVEGSMVLIKQGAEARVFESTFVGRRSIVKERFSKKYRHPSLDSKLTLKRLNAE 62 MEI LD +GS++LIKQGAEARVFES FVGRRSIVKERFSKKYRHPSLDSKLTLKRLNAE Sbjct: 1 MEIDLDVKDGSLILIKQGAEARVFESNFVGRRSIVKERFSKKYRHPSLDSKLTLKRLNAE 60 Query: 61 ARCMTKARKLGVSTPVLYAV 2 ARCMTKAR+LGVSTPVLYAV Sbjct: 61 ARCMTKARRLGVSTPVLYAV 80 >gb|EPS70566.1| hypothetical protein M569_04196, partial [Genlisea aurea] Length = 190 Score = 141 bits (355), Expect = 8e-40 Identities = 69/77 (89%), Positives = 76/77 (98%) Frame = -2 Query: 235 IKLDGVEGSMVLIKQGAEARVFESTFVGRRSIVKERFSKKYRHPSLDSKLTLKRLNAEAR 56 +++DG +GS++LIKQGAEARVFESTF+GRRSIVKERFSKKYRHPSLDSKLTLKRLNAEAR Sbjct: 1 MEIDGEQGSLILIKQGAEARVFESTFLGRRSIVKERFSKKYRHPSLDSKLTLKRLNAEAR 60 Query: 55 CMTKARKLGVSTPVLYA 5 CMTKARKLGVSTPVLYA Sbjct: 61 CMTKARKLGVSTPVLYA 77 >ref|XP_021821949.1| EKC/KEOPS complex subunit bud32 [Prunus avium] ref|XP_021821950.1| EKC/KEOPS complex subunit bud32 [Prunus avium] Length = 228 Score = 142 bits (358), Expect = 9e-40 Identities = 70/80 (87%), Positives = 77/80 (96%) Frame = -2 Query: 241 MEIKLDGVEGSMVLIKQGAEARVFESTFVGRRSIVKERFSKKYRHPSLDSKLTLKRLNAE 62 ME K DGV+GS++LIKQGAEARVFES+FVGRRSIVKERFSKKYRHPSLD+KLTLKRLNAE Sbjct: 1 METKADGVDGSLILIKQGAEARVFESSFVGRRSIVKERFSKKYRHPSLDAKLTLKRLNAE 60 Query: 61 ARCMTKARKLGVSTPVLYAV 2 ARCMTKAR+LGV TPVLY+V Sbjct: 61 ARCMTKARRLGVYTPVLYSV 80 >ref|XP_008235382.1| PREDICTED: EKC/KEOPS complex subunit bud32 [Prunus mume] ref|XP_016650596.1| PREDICTED: EKC/KEOPS complex subunit bud32 [Prunus mume] Length = 228 Score = 142 bits (358), Expect = 9e-40 Identities = 70/80 (87%), Positives = 77/80 (96%) Frame = -2 Query: 241 MEIKLDGVEGSMVLIKQGAEARVFESTFVGRRSIVKERFSKKYRHPSLDSKLTLKRLNAE 62 ME K DGV+GS++LIKQGAEARVFES+FVGRRSIVKERFSKKYRHPSLD+KLTLKRLNAE Sbjct: 1 METKADGVDGSLILIKQGAEARVFESSFVGRRSIVKERFSKKYRHPSLDAKLTLKRLNAE 60 Query: 61 ARCMTKARKLGVSTPVLYAV 2 ARCMTKAR+LGV TPVLY+V Sbjct: 61 ARCMTKARRLGVYTPVLYSV 80 >gb|OVA15526.1| Protein kinase domain [Macleaya cordata] Length = 226 Score = 142 bits (357), Expect = 1e-39 Identities = 71/80 (88%), Positives = 76/80 (95%) Frame = -2 Query: 241 MEIKLDGVEGSMVLIKQGAEARVFESTFVGRRSIVKERFSKKYRHPSLDSKLTLKRLNAE 62 M+IK DG EGS+VL+KQGAEARVFESTF+GRRS+VKERFSKKYRHPSLDSKLTLKRLNAE Sbjct: 1 MDIKQDGEEGSLVLLKQGAEARVFESTFMGRRSVVKERFSKKYRHPSLDSKLTLKRLNAE 60 Query: 61 ARCMTKARKLGVSTPVLYAV 2 ARCMTKAR LGV TPVLYAV Sbjct: 61 ARCMTKARGLGVYTPVLYAV 80 >ref|XP_009760169.1| PREDICTED: EKC/KEOPS complex subunit bud32-like isoform X2 [Nicotiana sylvestris] ref|XP_016457678.1| PREDICTED: EKC/KEOPS complex subunit bud32-like isoform X2 [Nicotiana tabacum] Length = 226 Score = 141 bits (356), Expect = 2e-39 Identities = 70/80 (87%), Positives = 76/80 (95%) Frame = -2 Query: 241 MEIKLDGVEGSMVLIKQGAEARVFESTFVGRRSIVKERFSKKYRHPSLDSKLTLKRLNAE 62 ME+K DG +GS+VLIKQGAEARVFESTFVGRR IVKERFSKKYRHP+LDSKLT KRLNAE Sbjct: 1 MELKADGSDGSLVLIKQGAEARVFESTFVGRRCIVKERFSKKYRHPTLDSKLTTKRLNAE 60 Query: 61 ARCMTKARKLGVSTPVLYAV 2 ARCMTKAR+LGV+TPVLYAV Sbjct: 61 ARCMTKARRLGVTTPVLYAV 80 >ref|XP_009760168.1| PREDICTED: EKC/KEOPS complex subunit bud32-like isoform X1 [Nicotiana sylvestris] ref|XP_016457677.1| PREDICTED: EKC/KEOPS complex subunit bud32-like isoform X1 [Nicotiana tabacum] Length = 271 Score = 142 bits (359), Expect = 2e-39 Identities = 71/83 (85%), Positives = 77/83 (92%) Frame = -2 Query: 250 LFTMEIKLDGVEGSMVLIKQGAEARVFESTFVGRRSIVKERFSKKYRHPSLDSKLTLKRL 71 L ME+K DG +GS+VLIKQGAEARVFESTFVGRR IVKERFSKKYRHP+LDSKLT KRL Sbjct: 43 LIDMELKADGSDGSLVLIKQGAEARVFESTFVGRRCIVKERFSKKYRHPTLDSKLTTKRL 102 Query: 70 NAEARCMTKARKLGVSTPVLYAV 2 NAEARCMTKAR+LGV+TPVLYAV Sbjct: 103 NAEARCMTKARRLGVTTPVLYAV 125 >gb|KDO68667.1| hypothetical protein CISIN_1g027265mg [Citrus sinensis] Length = 164 Score = 138 bits (348), Expect = 4e-39 Identities = 68/80 (85%), Positives = 75/80 (93%) Frame = -2 Query: 241 MEIKLDGVEGSMVLIKQGAEARVFESTFVGRRSIVKERFSKKYRHPSLDSKLTLKRLNAE 62 MEI + +GS++LIKQGAEARVFESTFVGRR +VKERFSKKYRHPSLDSK+TLKRLNAE Sbjct: 1 MEITANSEDGSLILIKQGAEARVFESTFVGRRCVVKERFSKKYRHPSLDSKITLKRLNAE 60 Query: 61 ARCMTKARKLGVSTPVLYAV 2 ARCMTKAR+LGVSTPVLYAV Sbjct: 61 ARCMTKARRLGVSTPVLYAV 80