BLASTX nr result
ID: Rehmannia30_contig00003832
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00003832 (420 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAN07021.1| putative mannitol transporter [Phelipanche ramosa] 87 3e-17 ref|XP_022882669.1| putative polyol transporter 1 [Olea europaea... 86 1e-16 ref|XP_022889518.1| polyol transporter 5-like isoform X2 [Olea e... 82 3e-15 gb|AFI61955.1| polyol transporter [Camellia sinensis] 80 1e-14 ref|XP_016441010.1| PREDICTED: polyol transporter 5-like [Nicoti... 77 5e-14 ref|XP_009785574.1| PREDICTED: polyol transporter 5-like isoform... 77 6e-14 ref|XP_009602627.1| PREDICTED: polyol transporter 5-like [Nicoti... 78 6e-14 ref|XP_012857335.1| PREDICTED: polyol transporter 5-like [Erythr... 77 8e-14 ref|XP_006349565.1| PREDICTED: polyol transporter 5-like [Solanu... 77 8e-14 gb|PHU21088.1| putative polyol transporter 1 [Capsicum chinense] 77 8e-14 gb|PHT85054.1| putative polyol transporter 1 [Capsicum annuum] 77 8e-14 ref|XP_016568246.1| PREDICTED: polyol transporter 5-like isoform... 77 8e-14 gb|PHT51312.1| putative polyol transporter 1 [Capsicum baccatum] 77 8e-14 ref|XP_011078884.1| polyol transporter 5 isoform X2 [Sesamum ind... 77 8e-14 ref|XP_011078883.1| polyol transporter 5 isoform X1 [Sesamum ind... 77 8e-14 ref|XP_016568245.1| PREDICTED: putative polyol transporter 1 iso... 77 9e-14 ref|XP_019188102.1| PREDICTED: polyol transporter 5-like [Ipomoe... 77 2e-13 ref|XP_009785575.1| PREDICTED: polyol transporter 5-like isoform... 75 2e-13 ref|XP_017223861.1| PREDICTED: putative polyol transporter 1 [Da... 75 4e-13 ref|XP_006349557.1| PREDICTED: polyol transporter 5-like [Solanu... 75 7e-13 >gb|AAN07021.1| putative mannitol transporter [Phelipanche ramosa] Length = 519 Score = 87.4 bits (215), Expect = 3e-17 Identities = 39/47 (82%), Positives = 43/47 (91%) Frame = +1 Query: 1 GIAVLTWIFFFTLLPETRGRTLEDMEVLFGSFFGWRNTMRELRKKES 141 GI ++TWIFFFTLLPETRGRTLEDMEVLFG+FF WR TMREL KKE+ Sbjct: 467 GIGIVTWIFFFTLLPETRGRTLEDMEVLFGTFFKWRTTMRELHKKEA 513 >ref|XP_022882669.1| putative polyol transporter 1 [Olea europaea var. sylvestris] Length = 529 Score = 85.5 bits (210), Expect = 1e-16 Identities = 37/53 (69%), Positives = 45/53 (84%) Frame = +1 Query: 1 GIAVLTWIFFFTLLPETRGRTLEDMEVLFGSFFGWRNTMRELRKKESANPNDG 159 G+A + WIFF+TLLPETRGRTLEDM+VLFG+F GWR+TMREL KK + +DG Sbjct: 468 GVATVAWIFFYTLLPETRGRTLEDMDVLFGTFCGWRSTMRELEKKRTEGNSDG 520 >ref|XP_022889518.1| polyol transporter 5-like isoform X2 [Olea europaea var. sylvestris] Length = 525 Score = 81.6 bits (200), Expect = 3e-15 Identities = 36/53 (67%), Positives = 45/53 (84%) Frame = +1 Query: 1 GIAVLTWIFFFTLLPETRGRTLEDMEVLFGSFFGWRNTMRELRKKESANPNDG 159 GIA++ WIFF+TLLPET+GRTLEDMEVLFG+FF WR+T REL+KK+ + G Sbjct: 471 GIAIVAWIFFYTLLPETQGRTLEDMEVLFGTFFRWRSTSRELKKKKLEGNSHG 523 >gb|AFI61955.1| polyol transporter [Camellia sinensis] Length = 532 Score = 79.7 bits (195), Expect = 1e-14 Identities = 31/52 (59%), Positives = 45/52 (86%) Frame = +1 Query: 1 GIAVLTWIFFFTLLPETRGRTLEDMEVLFGSFFGWRNTMRELRKKESANPND 156 G+A+++W+FF+TLLPET+GRTLE+M+VLFG+FF WR+T+RE+ K + ND Sbjct: 467 GVAIVSWVFFYTLLPETQGRTLEEMQVLFGTFFKWRSTLREMEKNKKIRDND 518 >ref|XP_016441010.1| PREDICTED: polyol transporter 5-like [Nicotiana tabacum] Length = 336 Score = 77.4 bits (189), Expect = 5e-14 Identities = 35/55 (63%), Positives = 46/55 (83%) Frame = +1 Query: 1 GIAVLTWIFFFTLLPETRGRTLEDMEVLFGSFFGWRNTMRELRKKESANPNDGDA 165 GIA++ WIFF+TLLPET+GRTLE+ME LFG+FF WR+TM+EL+K + +DG A Sbjct: 275 GIAIIAWIFFYTLLPETQGRTLEEMEELFGTFFKWRSTMKELKKNKV--ESDGSA 327 >ref|XP_009785574.1| PREDICTED: polyol transporter 5-like isoform X1 [Nicotiana sylvestris] Length = 355 Score = 77.4 bits (189), Expect = 6e-14 Identities = 35/55 (63%), Positives = 46/55 (83%) Frame = +1 Query: 1 GIAVLTWIFFFTLLPETRGRTLEDMEVLFGSFFGWRNTMRELRKKESANPNDGDA 165 GIA++ WIFF+TLLPET+GRTLE+ME LFG+FF WR+TM+EL+K + +DG A Sbjct: 275 GIAIIAWIFFYTLLPETQGRTLEEMEELFGTFFKWRSTMKELKKNKV--ESDGSA 327 >ref|XP_009602627.1| PREDICTED: polyol transporter 5-like [Nicotiana tomentosiformis] ref|XP_016446099.1| PREDICTED: polyol transporter 5-like [Nicotiana tabacum] Length = 531 Score = 77.8 bits (190), Expect = 6e-14 Identities = 36/55 (65%), Positives = 46/55 (83%) Frame = +1 Query: 1 GIAVLTWIFFFTLLPETRGRTLEDMEVLFGSFFGWRNTMRELRKKESANPNDGDA 165 GIAV+ WIFF+TLLPET+GRTLE+ME LFG+FF WR+TM+EL+K + +DG A Sbjct: 470 GIAVIAWIFFYTLLPETQGRTLEEMEELFGTFFKWRSTMKELKKNKV--ESDGSA 522 >ref|XP_012857335.1| PREDICTED: polyol transporter 5-like [Erythranthe guttata] gb|EYU20732.1| hypothetical protein MIMGU_mgv1a026176mg [Erythranthe guttata] Length = 509 Score = 77.4 bits (189), Expect = 8e-14 Identities = 34/49 (69%), Positives = 42/49 (85%) Frame = +1 Query: 1 GIAVLTWIFFFTLLPETRGRTLEDMEVLFGSFFGWRNTMRELRKKESAN 147 GIAV+ WIFF+TLLPET+GRTLE+ME LFG+FF WR+T +EL K+ AN Sbjct: 458 GIAVVAWIFFYTLLPETKGRTLEEMEDLFGTFFNWRSTSKELNIKKEAN 506 >ref|XP_006349565.1| PREDICTED: polyol transporter 5-like [Solanum tuberosum] Length = 518 Score = 77.4 bits (189), Expect = 8e-14 Identities = 32/51 (62%), Positives = 43/51 (84%) Frame = +1 Query: 1 GIAVLTWIFFFTLLPETRGRTLEDMEVLFGSFFGWRNTMRELRKKESANPN 153 GIA++ WIFF+TLLPET+GRTLE+ME LFG+FF WR+TM+EL++ P+ Sbjct: 466 GIAIVAWIFFYTLLPETKGRTLEEMEPLFGTFFKWRSTMKELKRSRVEGPD 516 >gb|PHU21088.1| putative polyol transporter 1 [Capsicum chinense] Length = 519 Score = 77.4 bits (189), Expect = 8e-14 Identities = 36/55 (65%), Positives = 45/55 (81%) Frame = +1 Query: 1 GIAVLTWIFFFTLLPETRGRTLEDMEVLFGSFFGWRNTMRELRKKESANPNDGDA 165 GIA++ WIFF+TLLPETRGRTLE+ME LFG+FF WR+TM+EL + N +GDA Sbjct: 461 GIAIMAWIFFYTLLPETRGRTLEEMEPLFGTFFRWRSTMKELDR----NKVEGDA 511 >gb|PHT85054.1| putative polyol transporter 1 [Capsicum annuum] Length = 519 Score = 77.4 bits (189), Expect = 8e-14 Identities = 36/55 (65%), Positives = 45/55 (81%) Frame = +1 Query: 1 GIAVLTWIFFFTLLPETRGRTLEDMEVLFGSFFGWRNTMRELRKKESANPNDGDA 165 GIA++ WIFF+TLLPETRGRTLE+ME LFG+FF WR+TM+EL + N +GDA Sbjct: 461 GIAIMAWIFFYTLLPETRGRTLEEMEPLFGTFFRWRSTMKELDR----NKVEGDA 511 >ref|XP_016568246.1| PREDICTED: polyol transporter 5-like isoform X2 [Capsicum annuum] ref|XP_016568247.1| PREDICTED: polyol transporter 5-like isoform X2 [Capsicum annuum] ref|XP_016568248.1| PREDICTED: polyol transporter 5-like isoform X2 [Capsicum annuum] Length = 519 Score = 77.4 bits (189), Expect = 8e-14 Identities = 36/55 (65%), Positives = 45/55 (81%) Frame = +1 Query: 1 GIAVLTWIFFFTLLPETRGRTLEDMEVLFGSFFGWRNTMRELRKKESANPNDGDA 165 GIA++ WIFF+TLLPETRGRTLE+ME LFG+FF WR+TM+EL + N +GDA Sbjct: 461 GIAIMAWIFFYTLLPETRGRTLEEMEPLFGTFFRWRSTMKELDR----NKVEGDA 511 >gb|PHT51312.1| putative polyol transporter 1 [Capsicum baccatum] Length = 521 Score = 77.4 bits (189), Expect = 8e-14 Identities = 36/55 (65%), Positives = 45/55 (81%) Frame = +1 Query: 1 GIAVLTWIFFFTLLPETRGRTLEDMEVLFGSFFGWRNTMRELRKKESANPNDGDA 165 GIA++ WIFF+TLLPETRGRTLE+ME LFG+FF WR+TM+EL + N +GDA Sbjct: 461 GIAIMAWIFFYTLLPETRGRTLEEMEPLFGTFFRWRSTMKELDR----NKVEGDA 511 >ref|XP_011078884.1| polyol transporter 5 isoform X2 [Sesamum indicum] Length = 524 Score = 77.4 bits (189), Expect = 8e-14 Identities = 32/46 (69%), Positives = 42/46 (91%) Frame = +1 Query: 1 GIAVLTWIFFFTLLPETRGRTLEDMEVLFGSFFGWRNTMRELRKKE 138 G+AV+ WIFF+TLLPET+GR LE++E LFGSFF WR+TMREL++K+ Sbjct: 472 GVAVIAWIFFYTLLPETQGRNLEEIEALFGSFFRWRSTMRELKRKK 517 >ref|XP_011078883.1| polyol transporter 5 isoform X1 [Sesamum indicum] Length = 526 Score = 77.4 bits (189), Expect = 8e-14 Identities = 32/46 (69%), Positives = 42/46 (91%) Frame = +1 Query: 1 GIAVLTWIFFFTLLPETRGRTLEDMEVLFGSFFGWRNTMRELRKKE 138 G+AV+ WIFF+TLLPET+GR LE++E LFGSFF WR+TMREL++K+ Sbjct: 474 GVAVIAWIFFYTLLPETQGRNLEEIEALFGSFFRWRSTMRELKRKK 519 >ref|XP_016568245.1| PREDICTED: putative polyol transporter 1 isoform X1 [Capsicum annuum] Length = 559 Score = 77.4 bits (189), Expect = 9e-14 Identities = 36/55 (65%), Positives = 45/55 (81%) Frame = +1 Query: 1 GIAVLTWIFFFTLLPETRGRTLEDMEVLFGSFFGWRNTMRELRKKESANPNDGDA 165 GIA++ WIFF+TLLPETRGRTLE+ME LFG+FF WR+TM+EL + N +GDA Sbjct: 501 GIAIMAWIFFYTLLPETRGRTLEEMEPLFGTFFRWRSTMKELDR----NKVEGDA 551 >ref|XP_019188102.1| PREDICTED: polyol transporter 5-like [Ipomoea nil] Length = 519 Score = 76.6 bits (187), Expect = 2e-13 Identities = 32/53 (60%), Positives = 44/53 (83%) Frame = +1 Query: 1 GIAVLTWIFFFTLLPETRGRTLEDMEVLFGSFFGWRNTMRELRKKESANPNDG 159 G++V+ W+FFFTL+PET+GRTLE+ E LFG+FF WR+TM+EL K+ A N+G Sbjct: 465 GVSVIAWVFFFTLMPETQGRTLEETESLFGTFFRWRSTMKELDGKKKAAENNG 517 >ref|XP_009785575.1| PREDICTED: polyol transporter 5-like isoform X2 [Nicotiana sylvestris] Length = 336 Score = 75.5 bits (184), Expect = 2e-13 Identities = 34/55 (61%), Positives = 45/55 (81%) Frame = +1 Query: 1 GIAVLTWIFFFTLLPETRGRTLEDMEVLFGSFFGWRNTMRELRKKESANPNDGDA 165 GIA++ WIFF+ LLPET+GRTLE+ME LFG+FF WR+TM+EL+K + +DG A Sbjct: 275 GIAIIAWIFFYALLPETQGRTLEEMEELFGTFFKWRSTMKELKKNKV--ESDGSA 327 >ref|XP_017223861.1| PREDICTED: putative polyol transporter 1 [Daucus carota subsp. sativus] gb|KZM81383.1| hypothetical protein DCAR_028996 [Daucus carota subsp. sativus] Length = 526 Score = 75.5 bits (184), Expect = 4e-13 Identities = 30/52 (57%), Positives = 42/52 (80%) Frame = +1 Query: 4 IAVLTWIFFFTLLPETRGRTLEDMEVLFGSFFGWRNTMRELRKKESANPNDG 159 +A + W+F FTL PET+GR LE++E+LFG +FGWR T+REL+KKE+A +G Sbjct: 471 VAAVGWVFMFTLFPETQGRNLEEVELLFGDYFGWRKTLRELKKKEAAEAKNG 522 >ref|XP_006349557.1| PREDICTED: polyol transporter 5-like [Solanum tuberosum] Length = 519 Score = 74.7 bits (182), Expect = 7e-13 Identities = 35/59 (59%), Positives = 47/59 (79%) Frame = +1 Query: 1 GIAVLTWIFFFTLLPETRGRTLEDMEVLFGSFFGWRNTMRELRKKESANPNDGDA*INS 177 G+A + WIFF+TLLPET+GRTLE+ME LFG+FF WR+TM+EL+K N +GD ++S Sbjct: 452 GVASVAWIFFYTLLPETKGRTLEEMEPLFGTFFKWRSTMKELKK----NRVEGDDMLSS 506