BLASTX nr result
ID: Rehmannia30_contig00003285
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00003285 (487 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN26717.1| (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synt... 52 3e-10 gb|PIN08006.1| (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synt... 52 3e-10 ref|XP_018819506.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl d... 52 4e-10 gb|AML23476.1| plastid 4-hydroxy-3-methylbut-2-enyl diphosphate ... 51 6e-10 gb|AJA39985.1| (E)-4-hydroxy-3-methylbut-2-enyl diphosphate synt... 51 6e-10 gb|AEZ55668.1| 4-hydroxy-3-methylbut-2-enyl diphosphate synthase... 51 6e-10 gb|AOX49856.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synth... 53 6e-10 ref|XP_011089897.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate ... 51 7e-10 ref|XP_021887012.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate ... 52 7e-10 gb|APY22346.1| (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synt... 52 7e-10 emb|CDP07116.1| unnamed protein product [Coffea canephora] 50 1e-09 ref|XP_011096438.1| beta-galactosidase 8 [Sesamum indicum] 67 1e-09 gb|AHA11129.1| chloroplast 4-hydroxy-3-methylbut-2-enyl diphosph... 50 2e-09 ref|XP_022887865.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate ... 49 2e-09 dbj|GAV66395.1| GcpE domain-containing protein [Cephalotus folli... 52 2e-09 gb|AEM42998.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synth... 50 2e-09 ref|XP_016169729.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate ... 48 3e-09 ref|XP_015935739.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate ... 48 3e-09 emb|CAN72185.1| hypothetical protein VITISV_005654 [Vitis vinifera] 52 4e-09 ref|XP_002285130.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl d... 52 4e-09 >gb|PIN26717.1| (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase [Handroanthus impetiginosus] Length = 744 Score = 51.6 bits (122), Expect(2) = 3e-10 Identities = 22/31 (70%), Positives = 28/31 (90%) Frame = -1 Query: 199 IIYVQFPKQIHRDDLVIGAGTNAGALLIESV 107 I ++QFPK+ HRDDLVIGAGTNAGALL++ + Sbjct: 579 IHHIQFPKETHRDDLVIGAGTNAGALLVDGL 609 Score = 40.8 bits (94), Expect(2) = 3e-10 Identities = 17/19 (89%), Positives = 19/19 (100%) Frame = -3 Query: 245 LFEYLAENSLDFPVIHHIR 189 LFEYL+ENSLDFPVIHHI+ Sbjct: 565 LFEYLSENSLDFPVIHHIQ 583 >gb|PIN08006.1| (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase [Handroanthus impetiginosus] Length = 744 Score = 51.6 bits (122), Expect(2) = 3e-10 Identities = 22/31 (70%), Positives = 28/31 (90%) Frame = -1 Query: 199 IIYVQFPKQIHRDDLVIGAGTNAGALLIESV 107 I ++QFPK+ HRDDLVIGAGTNAGALL++ + Sbjct: 579 IHHIQFPKETHRDDLVIGAGTNAGALLVDGL 609 Score = 40.8 bits (94), Expect(2) = 3e-10 Identities = 17/19 (89%), Positives = 19/19 (100%) Frame = -3 Query: 245 LFEYLAENSLDFPVIHHIR 189 LFEYL+ENSLDFPVIHHI+ Sbjct: 565 LFEYLSENSLDFPVIHHIQ 583 >ref|XP_018819506.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (ferredoxin), chloroplastic [Juglans regia] ref|XP_018819507.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (ferredoxin), chloroplastic [Juglans regia] ref|XP_018819508.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (ferredoxin), chloroplastic [Juglans regia] ref|XP_018819509.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (ferredoxin), chloroplastic [Juglans regia] ref|XP_018819510.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (ferredoxin), chloroplastic [Juglans regia] ref|XP_018819511.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (ferredoxin), chloroplastic [Juglans regia] ref|XP_018819512.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (ferredoxin), chloroplastic [Juglans regia] Length = 740 Score = 52.0 bits (123), Expect(3) = 4e-10 Identities = 23/31 (74%), Positives = 28/31 (90%) Frame = -1 Query: 199 IIYVQFPKQIHRDDLVIGAGTNAGALLIESV 107 I ++QFPK IHRDDLVIGAGTNAGALL++ + Sbjct: 575 IHHIQFPKGIHRDDLVIGAGTNAGALLVDGL 605 Score = 38.9 bits (89), Expect(3) = 4e-10 Identities = 16/19 (84%), Positives = 19/19 (100%) Frame = -3 Query: 245 LFEYLAENSLDFPVIHHIR 189 LFEYLA++SLDFPVIHHI+ Sbjct: 561 LFEYLADSSLDFPVIHHIQ 579 Score = 20.4 bits (41), Expect(3) = 4e-10 Identities = 7/15 (46%), Positives = 12/15 (80%) Frame = -2 Query: 291 SILLRELPAEDDKVA 247 ++LL ELP +DK++ Sbjct: 539 TMLLHELPLTEDKIS 553 >gb|AML23476.1| plastid 4-hydroxy-3-methylbut-2-enyl diphosphate synthase [Salvia miltiorrhiza] Length = 742 Score = 50.8 bits (120), Expect(2) = 6e-10 Identities = 22/31 (70%), Positives = 28/31 (90%) Frame = -1 Query: 199 IIYVQFPKQIHRDDLVIGAGTNAGALLIESV 107 I +++FPK IHRDDLVIGAGTNAGALL++ + Sbjct: 577 IHHIEFPKGIHRDDLVIGAGTNAGALLVDGL 607 Score = 40.4 bits (93), Expect(2) = 6e-10 Identities = 17/18 (94%), Positives = 18/18 (100%) Frame = -3 Query: 245 LFEYLAENSLDFPVIHHI 192 LFEYL+ENSLDFPVIHHI Sbjct: 563 LFEYLSENSLDFPVIHHI 580 >gb|AJA39985.1| (E)-4-hydroxy-3-methylbut-2-enyl diphosphate synthase [Salvia miltiorrhiza f. alba] Length = 742 Score = 50.8 bits (120), Expect(2) = 6e-10 Identities = 22/31 (70%), Positives = 28/31 (90%) Frame = -1 Query: 199 IIYVQFPKQIHRDDLVIGAGTNAGALLIESV 107 I +++FPK IHRDDLVIGAGTNAGALL++ + Sbjct: 577 IHHIEFPKGIHRDDLVIGAGTNAGALLVDGL 607 Score = 40.4 bits (93), Expect(2) = 6e-10 Identities = 17/18 (94%), Positives = 18/18 (100%) Frame = -3 Query: 245 LFEYLAENSLDFPVIHHI 192 LFEYL+ENSLDFPVIHHI Sbjct: 563 LFEYLSENSLDFPVIHHI 580 >gb|AEZ55668.1| 4-hydroxy-3-methylbut-2-enyl diphosphate synthase [Salvia miltiorrhiza] Length = 742 Score = 50.8 bits (120), Expect(2) = 6e-10 Identities = 22/31 (70%), Positives = 28/31 (90%) Frame = -1 Query: 199 IIYVQFPKQIHRDDLVIGAGTNAGALLIESV 107 I +++FPK IHRDDLVIGAGTNAGALL++ + Sbjct: 577 IHHIEFPKGIHRDDLVIGAGTNAGALLVDGL 607 Score = 40.4 bits (93), Expect(2) = 6e-10 Identities = 17/18 (94%), Positives = 18/18 (100%) Frame = -3 Query: 245 LFEYLAENSLDFPVIHHI 192 LFEYL+ENSLDFPVIHHI Sbjct: 563 LFEYLSENSLDFPVIHHI 580 >gb|AOX49856.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Ilex paraguariensis] Length = 740 Score = 52.8 bits (125), Expect(2) = 6e-10 Identities = 23/31 (74%), Positives = 28/31 (90%) Frame = -1 Query: 199 IIYVQFPKQIHRDDLVIGAGTNAGALLIESV 107 I ++QFPK IHRDDLVIGAGTNAGALL++ + Sbjct: 575 IHHIQFPKDIHRDDLVIGAGTNAGALLVDGL 605 Score = 38.5 bits (88), Expect(2) = 6e-10 Identities = 15/19 (78%), Positives = 19/19 (100%) Frame = -3 Query: 245 LFEYLAENSLDFPVIHHIR 189 LFEYL++N+LDFPVIHHI+ Sbjct: 561 LFEYLSDNALDFPVIHHIQ 579 >ref|XP_011089897.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (ferredoxin), chloroplastic [Sesamum indicum] ref|XP_011089899.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (ferredoxin), chloroplastic [Sesamum indicum] ref|XP_011089900.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (ferredoxin), chloroplastic [Sesamum indicum] ref|XP_020552331.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (ferredoxin), chloroplastic [Sesamum indicum] Length = 742 Score = 50.8 bits (120), Expect(2) = 7e-10 Identities = 22/31 (70%), Positives = 27/31 (87%) Frame = -1 Query: 199 IIYVQFPKQIHRDDLVIGAGTNAGALLIESV 107 I ++QFPK HRDDLVIGAGTNAGALL++ + Sbjct: 577 IHHIQFPKDTHRDDLVIGAGTNAGALLVDGL 607 Score = 40.0 bits (92), Expect(2) = 7e-10 Identities = 17/19 (89%), Positives = 19/19 (100%) Frame = -3 Query: 245 LFEYLAENSLDFPVIHHIR 189 LFEYLAENSL+FPVIHHI+ Sbjct: 563 LFEYLAENSLNFPVIHHIQ 581 >ref|XP_021887012.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (ferredoxin), chloroplastic [Carica papaya] Length = 740 Score = 52.0 bits (123), Expect(2) = 7e-10 Identities = 23/31 (74%), Positives = 28/31 (90%) Frame = -1 Query: 199 IIYVQFPKQIHRDDLVIGAGTNAGALLIESV 107 I ++QFPK IHRDDLVIGAGTNAGALL++ + Sbjct: 575 IHHIQFPKGIHRDDLVIGAGTNAGALLVDGL 605 Score = 38.9 bits (89), Expect(2) = 7e-10 Identities = 16/19 (84%), Positives = 19/19 (100%) Frame = -3 Query: 245 LFEYLAENSLDFPVIHHIR 189 LFEYLA+NSL+FPVIHHI+ Sbjct: 561 LFEYLADNSLNFPVIHHIQ 579 >gb|APY22346.1| (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase, partial [Hedera helix] Length = 740 Score = 52.0 bits (123), Expect(2) = 7e-10 Identities = 23/31 (74%), Positives = 28/31 (90%) Frame = -1 Query: 199 IIYVQFPKQIHRDDLVIGAGTNAGALLIESV 107 I ++QFPK IHRDDLVIGAGTNAGALL++ + Sbjct: 575 IHHIQFPKGIHRDDLVIGAGTNAGALLVDGL 605 Score = 38.9 bits (89), Expect(2) = 7e-10 Identities = 16/19 (84%), Positives = 19/19 (100%) Frame = -3 Query: 245 LFEYLAENSLDFPVIHHIR 189 LFEYL+ENSL+FPVIHHI+ Sbjct: 561 LFEYLSENSLNFPVIHHIQ 579 >emb|CDP07116.1| unnamed protein product [Coffea canephora] Length = 731 Score = 49.7 bits (117), Expect(2) = 1e-09 Identities = 21/31 (67%), Positives = 28/31 (90%) Frame = -1 Query: 199 IIYVQFPKQIHRDDLVIGAGTNAGALLIESV 107 I ++QFP+ IHRDDLVIGAG+NAGALL++ + Sbjct: 566 IHHIQFPRAIHRDDLVIGAGSNAGALLVDGL 596 Score = 40.8 bits (94), Expect(2) = 1e-09 Identities = 17/19 (89%), Positives = 19/19 (100%) Frame = -3 Query: 245 LFEYLAENSLDFPVIHHIR 189 LFEYL+ENSLDFPVIHHI+ Sbjct: 552 LFEYLSENSLDFPVIHHIQ 570 >ref|XP_011096438.1| beta-galactosidase 8 [Sesamum indicum] Length = 845 Score = 66.6 bits (161), Expect = 1e-09 Identities = 30/43 (69%), Positives = 36/43 (83%) Frame = -3 Query: 455 LFINIILQNYGPWLDVEGEKLYSVILTNLADSEKDLSSVQWTY 327 L + I LQNYGPW DV+G LYSV+LT+L DSE+DLSS+QWTY Sbjct: 549 LSMMIGLQNYGPWFDVQGAGLYSVVLTDLTDSEEDLSSMQWTY 591 >gb|AHA11129.1| chloroplast 4-hydroxy-3-methylbut-2-enyl diphosphate synthase [Picrorhiza kurrooa] Length = 748 Score = 50.4 bits (119), Expect(2) = 2e-09 Identities = 21/29 (72%), Positives = 26/29 (89%) Frame = -1 Query: 193 YVQFPKQIHRDDLVIGAGTNAGALLIESV 107 ++QFPK IHRDDLVIGAGTNAG LL++ + Sbjct: 585 HIQFPKAIHRDDLVIGAGTNAGGLLVDGL 613 Score = 38.9 bits (89), Expect(2) = 2e-09 Identities = 15/19 (78%), Positives = 19/19 (100%) Frame = -3 Query: 245 LFEYLAENSLDFPVIHHIR 189 LFEYL+ENSL+FPV+HHI+ Sbjct: 569 LFEYLSENSLEFPVVHHIQ 587 >ref|XP_022887865.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (ferredoxin), chloroplastic-like [Olea europaea var. sylvestris] ref|XP_022887867.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (ferredoxin), chloroplastic-like [Olea europaea var. sylvestris] Length = 742 Score = 48.9 bits (115), Expect(2) = 2e-09 Identities = 20/31 (64%), Positives = 28/31 (90%) Frame = -1 Query: 199 IIYVQFPKQIHRDDLVIGAGTNAGALLIESV 107 I +++FP +IHRDDLVIGAGTNAG+LL++ + Sbjct: 577 IHHIEFPSKIHRDDLVIGAGTNAGSLLVDGL 607 Score = 40.4 bits (93), Expect(2) = 2e-09 Identities = 17/18 (94%), Positives = 18/18 (100%) Frame = -3 Query: 245 LFEYLAENSLDFPVIHHI 192 LFEYL+ENSLDFPVIHHI Sbjct: 563 LFEYLSENSLDFPVIHHI 580 >dbj|GAV66395.1| GcpE domain-containing protein [Cephalotus follicularis] Length = 740 Score = 51.6 bits (122), Expect(2) = 2e-09 Identities = 22/29 (75%), Positives = 27/29 (93%) Frame = -1 Query: 193 YVQFPKQIHRDDLVIGAGTNAGALLIESV 107 ++QFPK IHRDDLVIGAGTNAGALL++ + Sbjct: 577 HIQFPKGIHRDDLVIGAGTNAGALLVDGL 605 Score = 37.7 bits (86), Expect(2) = 2e-09 Identities = 15/19 (78%), Positives = 18/19 (94%) Frame = -3 Query: 245 LFEYLAENSLDFPVIHHIR 189 LFEYLAEN L+FPV+HHI+ Sbjct: 561 LFEYLAENCLNFPVVHHIQ 579 >gb|AEM42998.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Siraitia grosvenorii] Length = 740 Score = 50.4 bits (119), Expect(2) = 2e-09 Identities = 22/31 (70%), Positives = 28/31 (90%) Frame = -1 Query: 199 IIYVQFPKQIHRDDLVIGAGTNAGALLIESV 107 I ++QFPK IHRDDLVIGAG+NAGALL++ + Sbjct: 575 IHHIQFPKGIHRDDLVIGAGSNAGALLVDGL 605 Score = 38.9 bits (89), Expect(2) = 2e-09 Identities = 16/19 (84%), Positives = 19/19 (100%) Frame = -3 Query: 245 LFEYLAENSLDFPVIHHIR 189 LFEYLAEN+L+FPVIHHI+ Sbjct: 561 LFEYLAENALNFPVIHHIQ 579 >ref|XP_016169729.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (ferredoxin), chloroplastic [Arachis ipaensis] ref|XP_016169730.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (ferredoxin), chloroplastic [Arachis ipaensis] Length = 743 Score = 48.1 bits (113), Expect(2) = 3e-09 Identities = 21/31 (67%), Positives = 27/31 (87%) Frame = -1 Query: 199 IIYVQFPKQIHRDDLVIGAGTNAGALLIESV 107 I ++QFP IHRDDLVIGAG+NAGALL++ + Sbjct: 578 IHHIQFPHGIHRDDLVIGAGSNAGALLVDGL 608 Score = 40.8 bits (94), Expect(2) = 3e-09 Identities = 17/19 (89%), Positives = 19/19 (100%) Frame = -3 Query: 245 LFEYLAENSLDFPVIHHIR 189 LFEYL+ENSLDFPVIHHI+ Sbjct: 564 LFEYLSENSLDFPVIHHIQ 582 >ref|XP_015935739.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (ferredoxin), chloroplastic [Arachis duranensis] ref|XP_015935740.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (ferredoxin), chloroplastic [Arachis duranensis] Length = 743 Score = 48.1 bits (113), Expect(2) = 3e-09 Identities = 21/31 (67%), Positives = 27/31 (87%) Frame = -1 Query: 199 IIYVQFPKQIHRDDLVIGAGTNAGALLIESV 107 I ++QFP IHRDDLVIGAG+NAGALL++ + Sbjct: 578 IHHIQFPHGIHRDDLVIGAGSNAGALLVDGL 608 Score = 40.8 bits (94), Expect(2) = 3e-09 Identities = 17/19 (89%), Positives = 19/19 (100%) Frame = -3 Query: 245 LFEYLAENSLDFPVIHHIR 189 LFEYL+ENSLDFPVIHHI+ Sbjct: 564 LFEYLSENSLDFPVIHHIQ 582 >emb|CAN72185.1| hypothetical protein VITISV_005654 [Vitis vinifera] Length = 740 Score = 52.0 bits (123), Expect(2) = 4e-09 Identities = 23/31 (74%), Positives = 28/31 (90%) Frame = -1 Query: 199 IIYVQFPKQIHRDDLVIGAGTNAGALLIESV 107 I ++QFPK IHRDDLVIGAGTNAGALL++ + Sbjct: 575 IHHIQFPKGIHRDDLVIGAGTNAGALLVDGL 605 Score = 36.6 bits (83), Expect(2) = 4e-09 Identities = 14/19 (73%), Positives = 19/19 (100%) Frame = -3 Query: 245 LFEYLAENSLDFPVIHHIR 189 LFEYL++N+L+FPVIHHI+ Sbjct: 561 LFEYLSDNALNFPVIHHIQ 579 >ref|XP_002285130.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (ferredoxin), chloroplastic [Vitis vinifera] emb|CBI16309.3| unnamed protein product, partial [Vitis vinifera] Length = 740 Score = 52.0 bits (123), Expect(2) = 4e-09 Identities = 23/31 (74%), Positives = 28/31 (90%) Frame = -1 Query: 199 IIYVQFPKQIHRDDLVIGAGTNAGALLIESV 107 I ++QFPK IHRDDLVIGAGTNAGALL++ + Sbjct: 575 IHHIQFPKGIHRDDLVIGAGTNAGALLVDGL 605 Score = 36.6 bits (83), Expect(2) = 4e-09 Identities = 14/19 (73%), Positives = 19/19 (100%) Frame = -3 Query: 245 LFEYLAENSLDFPVIHHIR 189 LFEYL++N+L+FPVIHHI+ Sbjct: 561 LFEYLSDNALNFPVIHHIQ 579