BLASTX nr result
ID: Rehmannia30_contig00003269
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00003269 (631 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012843273.1| PREDICTED: uncharacterized protein LOC105963... 57 6e-06 >ref|XP_012843273.1| PREDICTED: uncharacterized protein LOC105963417 [Erythranthe guttata] ref|XP_012843275.1| PREDICTED: uncharacterized protein LOC105963417 [Erythranthe guttata] Length = 633 Score = 57.0 bits (136), Expect = 6e-06 Identities = 31/75 (41%), Positives = 45/75 (60%), Gaps = 1/75 (1%) Frame = +3 Query: 105 MELYCDTHDALNDVKRSEMNCKQLDSQWDDCKKLVEENNIDCDYQRMLRFILSKAEIYEQ 284 ME Y DTHD L+DVK N KQL D+ +++VE NN+D +YQ L L A ++ Sbjct: 3 MERYYDTHDVLHDVKSMMANSKQL----DELRRVVEGNNVDPNYQLFLLSALRSANSHKH 58 Query: 285 HKR-ERDNVIIIDEE 326 K ER+N + +D++ Sbjct: 59 QKEIERENFVSVDDD 73