BLASTX nr result
ID: Rehmannia30_contig00002184
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00002184 (1398 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_019153059.1| PREDICTED: serine/arginine-rich splicing fac... 103 2e-21 ref|XP_011074178.1| serine/arginine-rich splicing factor SC35 [S... 103 2e-21 emb|CDP01049.1| unnamed protein product [Coffea canephora] 100 4e-20 ref|XP_022855127.1| serine/arginine-rich splicing factor SC35-li... 100 5e-20 ref|XP_019233874.1| PREDICTED: serine/arginine-rich splicing fac... 100 5e-20 ref|XP_009761421.1| PREDICTED: serine/arginine-rich splicing fac... 100 5e-20 ref|XP_022855126.1| serine/arginine-rich splicing factor SC35-li... 100 5e-20 ref|XP_019233873.1| PREDICTED: serine/arginine-rich splicing fac... 98 2e-19 ref|XP_009761420.1| PREDICTED: serine/arginine-rich splicing fac... 98 2e-19 gb|ONM59809.1| Serine/arginine-rich splicing factor SC35 [Zea mays] 97 3e-19 gb|ACR36750.1| unknown [Zea mays] >gi|1142666129|gb|ONM25451.1| ... 96 4e-19 gb|ONM59811.1| Serine/arginine-rich splicing factor SC35 [Zea mays] 97 4e-19 gb|KZV34433.1| hypothetical protein F511_23407 [Dorcoceras hygro... 93 4e-19 ref|NP_001169755.1| uncharacterized protein LOC100383636 [Zea ma... 97 5e-19 gb|ONM59807.1| Serine/arginine-rich splicing factor SC35 [Zea mays] 97 5e-19 gb|ONM59805.1| Serine/arginine-rich splicing factor SC35 [Zea ma... 97 6e-19 ref|XP_009606953.1| PREDICTED: serine/arginine-rich splicing fac... 97 6e-19 gb|KVH98558.1| Nucleotide-binding, alpha-beta plait [Cynara card... 97 6e-19 gb|ONM25444.1| Serine/arginine-rich splicing factor SC35 [Zea ma... 96 7e-19 ref|XP_020403092.1| uncharacterized protein LOC100272627 isoform... 96 8e-19 >ref|XP_019153059.1| PREDICTED: serine/arginine-rich splicing factor SC35-like [Ipomoea nil] Length = 255 Score = 103 bits (258), Expect = 2e-21 Identities = 49/51 (96%), Positives = 51/51 (100%) Frame = +1 Query: 1 FVRYKYQDEAQKAVEKLDGRLVDGREIMVQFAKYGPNAERIHKGRIEEPVH 153 FVRYKYQDEAQKAVEKLDG+LVDGREIMVQFAKYGPNAERIHKGRIEEPV+ Sbjct: 61 FVRYKYQDEAQKAVEKLDGKLVDGREIMVQFAKYGPNAERIHKGRIEEPVY 111 >ref|XP_011074178.1| serine/arginine-rich splicing factor SC35 [Sesamum indicum] Length = 255 Score = 103 bits (258), Expect = 2e-21 Identities = 49/51 (96%), Positives = 51/51 (100%) Frame = +1 Query: 1 FVRYKYQDEAQKAVEKLDGRLVDGREIMVQFAKYGPNAERIHKGRIEEPVH 153 FVRYKYQDEAQKAVEKLDGR+VDGREIMVQFAKYGPNAERIHKGRIEEPV+ Sbjct: 61 FVRYKYQDEAQKAVEKLDGRVVDGREIMVQFAKYGPNAERIHKGRIEEPVY 111 >emb|CDP01049.1| unnamed protein product [Coffea canephora] Length = 255 Score = 100 bits (248), Expect = 4e-20 Identities = 47/51 (92%), Positives = 50/51 (98%) Frame = +1 Query: 1 FVRYKYQDEAQKAVEKLDGRLVDGREIMVQFAKYGPNAERIHKGRIEEPVH 153 FVRYKYQDEAQKAVEKLDGR+VDGREIMVQFAKYGPNAERIHKG+I EPV+ Sbjct: 61 FVRYKYQDEAQKAVEKLDGRVVDGREIMVQFAKYGPNAERIHKGKIMEPVY 111 >ref|XP_022855127.1| serine/arginine-rich splicing factor SC35-like isoform X2 [Olea europaea var. sylvestris] Length = 253 Score = 99.8 bits (247), Expect = 5e-20 Identities = 47/50 (94%), Positives = 49/50 (98%) Frame = +1 Query: 1 FVRYKYQDEAQKAVEKLDGRLVDGREIMVQFAKYGPNAERIHKGRIEEPV 150 FVRYKYQDEA+KAVEKLDG+LVDGREIMVQFAKYGPNAERIHKGRI EPV Sbjct: 61 FVRYKYQDEARKAVEKLDGKLVDGREIMVQFAKYGPNAERIHKGRISEPV 110 >ref|XP_019233874.1| PREDICTED: serine/arginine-rich splicing factor SC35-like [Nicotiana attenuata] Length = 254 Score = 99.8 bits (247), Expect = 5e-20 Identities = 48/51 (94%), Positives = 49/51 (96%) Frame = +1 Query: 1 FVRYKYQDEAQKAVEKLDGRLVDGREIMVQFAKYGPNAERIHKGRIEEPVH 153 FVRYKYQDEAQKAVEKLDGR+VDGREIMVQFAKYGPNAERI KGRI EPVH Sbjct: 61 FVRYKYQDEAQKAVEKLDGRVVDGREIMVQFAKYGPNAERIDKGRILEPVH 111 >ref|XP_009761421.1| PREDICTED: serine/arginine-rich splicing factor SC35-like [Nicotiana sylvestris] ref|XP_016514369.1| PREDICTED: serine/arginine-rich splicing factor SC35-like [Nicotiana tabacum] Length = 254 Score = 99.8 bits (247), Expect = 5e-20 Identities = 48/51 (94%), Positives = 49/51 (96%) Frame = +1 Query: 1 FVRYKYQDEAQKAVEKLDGRLVDGREIMVQFAKYGPNAERIHKGRIEEPVH 153 FVRYKYQDEAQKAVEKLDGR+VDGREIMVQFAKYGPNAERI KGRI EPVH Sbjct: 61 FVRYKYQDEAQKAVEKLDGRVVDGREIMVQFAKYGPNAERIDKGRILEPVH 111 >ref|XP_022855126.1| serine/arginine-rich splicing factor SC35-like isoform X1 [Olea europaea var. sylvestris] Length = 260 Score = 99.8 bits (247), Expect = 5e-20 Identities = 47/50 (94%), Positives = 49/50 (98%) Frame = +1 Query: 1 FVRYKYQDEAQKAVEKLDGRLVDGREIMVQFAKYGPNAERIHKGRIEEPV 150 FVRYKYQDEA+KAVEKLDG+LVDGREIMVQFAKYGPNAERIHKGRI EPV Sbjct: 61 FVRYKYQDEARKAVEKLDGKLVDGREIMVQFAKYGPNAERIHKGRISEPV 110 >ref|XP_019233873.1| PREDICTED: serine/arginine-rich splicing factor SC35-like [Nicotiana attenuata] Length = 254 Score = 98.2 bits (243), Expect = 2e-19 Identities = 47/51 (92%), Positives = 49/51 (96%) Frame = +1 Query: 1 FVRYKYQDEAQKAVEKLDGRLVDGREIMVQFAKYGPNAERIHKGRIEEPVH 153 FVRYKYQDEAQKAVEKLDGR+VDGREIMV+FAKYGPNAERI KGRI EPVH Sbjct: 61 FVRYKYQDEAQKAVEKLDGRVVDGREIMVRFAKYGPNAERIDKGRILEPVH 111 >ref|XP_009761420.1| PREDICTED: serine/arginine-rich splicing factor SC35-like [Nicotiana sylvestris] Length = 254 Score = 98.2 bits (243), Expect = 2e-19 Identities = 47/51 (92%), Positives = 49/51 (96%) Frame = +1 Query: 1 FVRYKYQDEAQKAVEKLDGRLVDGREIMVQFAKYGPNAERIHKGRIEEPVH 153 FVRYKYQDEAQKAVEKLDGR+VDGREIMV+FAKYGPNAERI KGRI EPVH Sbjct: 61 FVRYKYQDEAQKAVEKLDGRVVDGREIMVRFAKYGPNAERIDKGRILEPVH 111 >gb|ONM59809.1| Serine/arginine-rich splicing factor SC35 [Zea mays] Length = 219 Score = 96.7 bits (239), Expect = 3e-19 Identities = 46/50 (92%), Positives = 49/50 (98%) Frame = +1 Query: 1 FVRYKYQDEAQKAVEKLDGRLVDGREIMVQFAKYGPNAERIHKGRIEEPV 150 FVRYKY+DEAQKAVE+LDGRLVDGREIMVQFAKYGPNAERI+KGRI EPV Sbjct: 62 FVRYKYEDEAQKAVERLDGRLVDGREIMVQFAKYGPNAERINKGRIVEPV 111 >gb|ACR36750.1| unknown [Zea mays] gb|ONM25451.1| Serine/arginine-rich splicing factor SC35 [Zea mays] Length = 190 Score = 95.5 bits (236), Expect = 4e-19 Identities = 45/50 (90%), Positives = 49/50 (98%) Frame = +1 Query: 1 FVRYKYQDEAQKAVEKLDGRLVDGREIMVQFAKYGPNAERIHKGRIEEPV 150 FVRYKY+DEAQKAV++LDGRLVDGREIMVQFAKYGPNAERI+KGRI EPV Sbjct: 62 FVRYKYEDEAQKAVDRLDGRLVDGREIMVQFAKYGPNAERINKGRIMEPV 111 >gb|ONM59811.1| Serine/arginine-rich splicing factor SC35 [Zea mays] Length = 233 Score = 96.7 bits (239), Expect = 4e-19 Identities = 46/50 (92%), Positives = 49/50 (98%) Frame = +1 Query: 1 FVRYKYQDEAQKAVEKLDGRLVDGREIMVQFAKYGPNAERIHKGRIEEPV 150 FVRYKY+DEAQKAVE+LDGRLVDGREIMVQFAKYGPNAERI+KGRI EPV Sbjct: 62 FVRYKYEDEAQKAVERLDGRLVDGREIMVQFAKYGPNAERINKGRIVEPV 111 >gb|KZV34433.1| hypothetical protein F511_23407 [Dorcoceras hygrometricum] Length = 125 Score = 93.2 bits (230), Expect = 4e-19 Identities = 44/51 (86%), Positives = 48/51 (94%) Frame = +1 Query: 1 FVRYKYQDEAQKAVEKLDGRLVDGREIMVQFAKYGPNAERIHKGRIEEPVH 153 FVRYK+QDEA KAVEKLDGR+VDGREIMVQFAKYGPNAER +KGRI EPV+ Sbjct: 61 FVRYKHQDEAAKAVEKLDGRVVDGREIMVQFAKYGPNAERTNKGRISEPVY 111 >ref|NP_001169755.1| uncharacterized protein LOC100383636 [Zea mays] gb|ACN34810.1| unknown [Zea mays] gb|ONM59812.1| Serine/arginine-rich splicing factor SC35 [Zea mays] Length = 246 Score = 96.7 bits (239), Expect = 5e-19 Identities = 46/50 (92%), Positives = 49/50 (98%) Frame = +1 Query: 1 FVRYKYQDEAQKAVEKLDGRLVDGREIMVQFAKYGPNAERIHKGRIEEPV 150 FVRYKY+DEAQKAVE+LDGRLVDGREIMVQFAKYGPNAERI+KGRI EPV Sbjct: 62 FVRYKYEDEAQKAVERLDGRLVDGREIMVQFAKYGPNAERINKGRIVEPV 111 >gb|ONM59807.1| Serine/arginine-rich splicing factor SC35 [Zea mays] Length = 247 Score = 96.7 bits (239), Expect = 5e-19 Identities = 46/50 (92%), Positives = 49/50 (98%) Frame = +1 Query: 1 FVRYKYQDEAQKAVEKLDGRLVDGREIMVQFAKYGPNAERIHKGRIEEPV 150 FVRYKY+DEAQKAVE+LDGRLVDGREIMVQFAKYGPNAERI+KGRI EPV Sbjct: 62 FVRYKYEDEAQKAVERLDGRLVDGREIMVQFAKYGPNAERINKGRIVEPV 111 >gb|ONM59805.1| Serine/arginine-rich splicing factor SC35 [Zea mays] gb|ONM59810.1| Serine/arginine-rich splicing factor SC35 [Zea mays] Length = 254 Score = 96.7 bits (239), Expect = 6e-19 Identities = 46/50 (92%), Positives = 49/50 (98%) Frame = +1 Query: 1 FVRYKYQDEAQKAVEKLDGRLVDGREIMVQFAKYGPNAERIHKGRIEEPV 150 FVRYKY+DEAQKAVE+LDGRLVDGREIMVQFAKYGPNAERI+KGRI EPV Sbjct: 62 FVRYKYEDEAQKAVERLDGRLVDGREIMVQFAKYGPNAERINKGRIVEPV 111 >ref|XP_009606953.1| PREDICTED: serine/arginine-rich splicing factor SC35-like [Nicotiana tomentosiformis] ref|XP_016489036.1| PREDICTED: serine/arginine-rich splicing factor SC35-like [Nicotiana tabacum] Length = 254 Score = 96.7 bits (239), Expect = 6e-19 Identities = 47/50 (94%), Positives = 48/50 (96%) Frame = +1 Query: 1 FVRYKYQDEAQKAVEKLDGRLVDGREIMVQFAKYGPNAERIHKGRIEEPV 150 FVRYKYQDEAQKAVEKLDGR+VDGREIMVQFAKYGPNAERI KGRI EPV Sbjct: 61 FVRYKYQDEAQKAVEKLDGRVVDGREIMVQFAKYGPNAERIDKGRILEPV 110 >gb|KVH98558.1| Nucleotide-binding, alpha-beta plait [Cynara cardunculus var. scolymus] Length = 256 Score = 96.7 bits (239), Expect = 6e-19 Identities = 46/50 (92%), Positives = 48/50 (96%) Frame = +1 Query: 1 FVRYKYQDEAQKAVEKLDGRLVDGREIMVQFAKYGPNAERIHKGRIEEPV 150 FVRYKY DEAQKAVEKLDGR+VDGRE+MVQFAKYGPNAERIHKGRI EPV Sbjct: 61 FVRYKYADEAQKAVEKLDGRVVDGREMMVQFAKYGPNAERIHKGRILEPV 110 >gb|ONM25444.1| Serine/arginine-rich splicing factor SC35 [Zea mays] gb|ONM25445.1| Serine/arginine-rich splicing factor SC35 [Zea mays] gb|ONM25456.1| Serine/arginine-rich splicing factor SC35 [Zea mays] Length = 221 Score = 95.5 bits (236), Expect = 7e-19 Identities = 45/50 (90%), Positives = 49/50 (98%) Frame = +1 Query: 1 FVRYKYQDEAQKAVEKLDGRLVDGREIMVQFAKYGPNAERIHKGRIEEPV 150 FVRYKY+DEAQKAV++LDGRLVDGREIMVQFAKYGPNAERI+KGRI EPV Sbjct: 62 FVRYKYEDEAQKAVDRLDGRLVDGREIMVQFAKYGPNAERINKGRIMEPV 111 >ref|XP_020403092.1| uncharacterized protein LOC100272627 isoform X5 [Zea mays] gb|ONM25449.1| Serine/arginine-rich splicing factor SC35 [Zea mays] Length = 224 Score = 95.5 bits (236), Expect = 8e-19 Identities = 45/50 (90%), Positives = 49/50 (98%) Frame = +1 Query: 1 FVRYKYQDEAQKAVEKLDGRLVDGREIMVQFAKYGPNAERIHKGRIEEPV 150 FVRYKY+DEAQKAV++LDGRLVDGREIMVQFAKYGPNAERI+KGRI EPV Sbjct: 62 FVRYKYEDEAQKAVDRLDGRLVDGREIMVQFAKYGPNAERINKGRIMEPV 111