BLASTX nr result
ID: Rehmannia29_contig00038404
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00038404 (658 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PON86642.1| hypothetical protein TorRG33x02_175780 [Trema ori... 54 3e-06 >gb|PON86642.1| hypothetical protein TorRG33x02_175780 [Trema orientalis] Length = 100 Score = 54.3 bits (129), Expect = 3e-06 Identities = 23/48 (47%), Positives = 32/48 (66%) Frame = +1 Query: 391 ERDKRFFDDMEEYLEEVWYRIKFRAAWWIPNHNEFKNLFVSDLVRDWS 534 ER+KR FDD +E L +W ++K+ A W+ + FK+L SDL RDWS Sbjct: 50 ERNKRIFDDAKEDLNSIWEKVKYLVALWVYDTRFFKDLSFSDLCRDWS 97