BLASTX nr result
ID: Rehmannia28_contig00052594
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00052594 (374 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AKT44365.1| heat shock protein 3 [Tectona grandis] 56 2e-07 ref|XP_011095836.1| PREDICTED: 18.1 kDa class I heat shock prote... 55 7e-07 >gb|AKT44365.1| heat shock protein 3 [Tectona grandis] Length = 162 Score = 56.2 bits (134), Expect = 2e-07 Identities = 28/37 (75%), Positives = 30/37 (81%) Frame = -1 Query: 113 MSVFPLRSLLSDPSFTSVFGLGIGPSETGAFMDWKET 3 MSVFPLRSLLSDP F+ VFGL GPS+ G MDWKET Sbjct: 1 MSVFPLRSLLSDPFFSDVFGL--GPSKAGLSMDWKET 35 >ref|XP_011095836.1| PREDICTED: 18.1 kDa class I heat shock protein-like [Sesamum indicum] Length = 163 Score = 54.7 bits (130), Expect = 7e-07 Identities = 28/37 (75%), Positives = 29/37 (78%) Frame = -1 Query: 113 MSVFPLRSLLSDPSFTSVFGLGIGPSETGAFMDWKET 3 MSVF LRSLLSDP F+ FGL GPS TGA MDWKET Sbjct: 1 MSVFGLRSLLSDPVFSEAFGL--GPSRTGASMDWKET 35