BLASTX nr result
ID: Rehmannia28_contig00051481
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00051481 (564 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011090000.1| PREDICTED: splicing factor U2af small subuni... 64 9e-09 >ref|XP_011090000.1| PREDICTED: splicing factor U2af small subunit B-like [Sesamum indicum] gi|747085118|ref|XP_011090001.1| PREDICTED: splicing factor U2af small subunit B-like [Sesamum indicum] Length = 320 Score = 63.5 bits (153), Expect = 9e-09 Identities = 41/98 (41%), Positives = 51/98 (52%), Gaps = 12/98 (12%) Frame = +3 Query: 3 RNYQEIRSRRKRSTSPGRRKDRSTSPS--------REGSQKRRAKKRKIEHCYSEREHGT 158 R+Y + RSR+ RSTSP RR+ RS SP REGS++RRAK + E E + Sbjct: 223 RDYHDSRSRKHRSTSPSRRRGRSRSPGGRRDRSPVREGSEERRAKIAQWNREKEEAERAS 282 Query: 159 KADAG----KDEISRLKYQRM*IHYHRQDPPHRNRLGY 260 KA+AG K E Y H QDPP +N GY Sbjct: 283 KANAGGDVDKKENDNHGYVESGDHNRGQDPPQQNGYGY 320