BLASTX nr result
ID: Rehmannia28_contig00051136
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00051136 (363 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EJK58437.1| hypothetical protein THAOC_21438 [Thalassiosira o... 57 4e-08 ref|XP_003850788.1| hypothetical protein MYCGRDRAFT_45585 [Zymos... 54 1e-07 gb|KMS93623.1| hypothetical protein BVRB_029610, partial [Beta v... 53 2e-07 ref|XP_002488936.1| hypothetical protein SORBIDRAFT_1514s002010 ... 53 2e-07 gb|EMS64240.1| hypothetical protein TRIUR3_08371 [Triticum urartu] 53 2e-07 ref|WP_016885142.1| MULTISPECIES: hypothetical protein [Bacteria] 53 3e-07 ref|WP_045623793.1| hypothetical protein [Vibrio vulnificus] gi|... 53 3e-07 ref|WP_046876397.1| hypothetical protein, partial [Vibrio paraha... 53 3e-07 ref|XP_002488959.1| hypothetical protein SORBIDRAFT_1180s002020 ... 53 4e-07 ref|XP_002449484.1| hypothetical protein SORBIDRAFT_05g016450 [S... 50 4e-06 gb|EMS62447.1| hypothetical protein TRIUR3_00139 [Triticum urartu] 50 5e-06 ref|XP_012850107.1| PREDICTED: uncharacterized protein LOC105969... 53 8e-06 >gb|EJK58437.1| hypothetical protein THAOC_21438 [Thalassiosira oceanica] Length = 104 Score = 56.6 bits (135), Expect = 4e-08 Identities = 30/44 (68%), Positives = 32/44 (72%) Frame = -1 Query: 147 SYFVGLQDEGMFNRISRGYPNLEVRGEILGFSKVELLRKHLSRM 16 +YFVGL+ E M NR S GY VRGEILGF K ELLRKHL RM Sbjct: 16 NYFVGLRYEVMINRDSWGYSYFVVRGEILGFPKDELLRKHLPRM 59 >ref|XP_003850788.1| hypothetical protein MYCGRDRAFT_45585 [Zymoseptoria tritici IPO323] gi|339470667|gb|EGP85764.1| hypothetical protein MYCGRDRAFT_45585 [Zymoseptoria tritici IPO323] gi|452836062|gb|EME38013.1| hypothetical protein DOTSEDRAFT_141299 [Dothistroma septosporum NZE10] gi|452836073|gb|EME38022.1| hypothetical protein DOTSEDRAFT_116518, partial [Dothistroma septosporum NZE10] gi|453079850|gb|EMF07908.1| hypothetical protein SEPMUDRAFT_145509 [Sphaerulina musiva SO2202] Length = 61 Score = 53.9 bits (128), Expect = 1e-07 Identities = 28/38 (73%), Positives = 30/38 (78%) Frame = -1 Query: 117 MFNRISRGYPNLEVRGEILGFSKVELLRKHLSRMFSLI 4 M NR SRG+P VRGEILGF + ELLRKHL RMFSLI Sbjct: 1 MINRDSRGHPYSIVRGEILGFIEDELLRKHLPRMFSLI 38 >gb|KMS93623.1| hypothetical protein BVRB_029610, partial [Beta vulgaris subsp. vulgaris] Length = 51 Score = 53.1 bits (126), Expect = 2e-07 Identities = 28/39 (71%), Positives = 29/39 (74%) Frame = -1 Query: 117 MFNRISRGYPNLEVRGEILGFSKVELLRKHLSRMFSLIK 1 M R SRG+ VRGEILGF K ELLRKHL RMFSLIK Sbjct: 4 MIKRDSRGHSYFIVRGEILGFMKDELLRKHLPRMFSLIK 42 >ref|XP_002488936.1| hypothetical protein SORBIDRAFT_1514s002010 [Sorghum bicolor] gi|253759636|ref|XP_002488938.1| hypothetical protein SORBIDRAFT_1506s002010 [Sorghum bicolor] gi|253759935|ref|XP_002488954.1| hypothetical protein SORBIDRAFT_1236s002010 [Sorghum bicolor] gi|253759972|ref|XP_002488957.1| hypothetical protein SORBIDRAFT_1205s002020 [Sorghum bicolor] gi|253760151|ref|XP_002488969.1| hypothetical protein SORBIDRAFT_1050s002020 [Sorghum bicolor] gi|253760863|ref|XP_002489025.1| hypothetical protein SORBIDRAFT_0450s002020 [Sorghum bicolor] gi|253761034|ref|XP_002489038.1| hypothetical protein SORBIDRAFT_0304s002010 [Sorghum bicolor] gi|297836874|ref|XP_002886319.1| expressed protein [Arabidopsis lyrata subsp. lyrata] gi|219887055|gb|ACL53902.1| unknown [Zea mays] gi|241946941|gb|EES20086.1| hypothetical protein SORBIDRAFT_1050s002020 [Sorghum bicolor] gi|241947045|gb|EES20190.1| hypothetical protein SORBIDRAFT_1205s002020 [Sorghum bicolor] gi|241947052|gb|EES20197.1| hypothetical protein SORBIDRAFT_1236s002010 [Sorghum bicolor] gi|241947162|gb|EES20307.1| hypothetical protein SORBIDRAFT_1506s002010 [Sorghum bicolor] gi|241947163|gb|EES20308.1| hypothetical protein SORBIDRAFT_1514s002010 [Sorghum bicolor] gi|241947314|gb|EES20459.1| hypothetical protein SORBIDRAFT_0304s002010 [Sorghum bicolor] gi|241947338|gb|EES20483.1| hypothetical protein SORBIDRAFT_0450s002020 [Sorghum bicolor] gi|297332159|gb|EFH62578.1| expressed protein [Arabidopsis lyrata subsp. lyrata] gi|902197674|gb|KNA13494.1| hypothetical protein SOVF_116400 [Spinacia oleracea] Length = 52 Score = 53.1 bits (126), Expect = 2e-07 Identities = 28/39 (71%), Positives = 29/39 (74%) Frame = -1 Query: 117 MFNRISRGYPNLEVRGEILGFSKVELLRKHLSRMFSLIK 1 M NR SRG+ VRGEILGF K E LRKHL RMFSLIK Sbjct: 1 MINRDSRGHSYFIVRGEILGFMKDEQLRKHLPRMFSLIK 39 >gb|EMS64240.1| hypothetical protein TRIUR3_08371 [Triticum urartu] Length = 52 Score = 53.1 bits (126), Expect = 2e-07 Identities = 28/39 (71%), Positives = 29/39 (74%) Frame = -1 Query: 117 MFNRISRGYPNLEVRGEILGFSKVELLRKHLSRMFSLIK 1 M NR SRG+ VRGEILGF K E LRKHL RMFSLIK Sbjct: 1 MINRDSRGHSYFIVRGEILGFMKDEQLRKHLPRMFSLIK 39 >ref|WP_016885142.1| MULTISPECIES: hypothetical protein [Bacteria] Length = 59 Score = 53.1 bits (126), Expect = 3e-07 Identities = 28/39 (71%), Positives = 29/39 (74%) Frame = -1 Query: 117 MFNRISRGYPNLEVRGEILGFSKVELLRKHLSRMFSLIK 1 M NR SRG+ VRGEILGF K E LRKHL RMFSLIK Sbjct: 8 MINRDSRGHSYFIVRGEILGFMKDEQLRKHLPRMFSLIK 46 >ref|WP_045623793.1| hypothetical protein [Vibrio vulnificus] gi|974706164|emb|CUW79419.1| conserved hypothetical protein [Escherichia coli] Length = 60 Score = 53.1 bits (126), Expect = 3e-07 Identities = 28/39 (71%), Positives = 29/39 (74%) Frame = -1 Query: 117 MFNRISRGYPNLEVRGEILGFSKVELLRKHLSRMFSLIK 1 M NR SRG+ VRGEILGF K E LRKHL RMFSLIK Sbjct: 9 MINRDSRGHSYFIVRGEILGFMKDEQLRKHLPRMFSLIK 47 >ref|WP_046876397.1| hypothetical protein, partial [Vibrio parahaemolyticus] gi|821242584|gb|KKZ05227.1| hypothetical protein YC68_24375, partial [Vibrio parahaemolyticus] Length = 66 Score = 53.1 bits (126), Expect = 3e-07 Identities = 28/39 (71%), Positives = 29/39 (74%) Frame = -1 Query: 117 MFNRISRGYPNLEVRGEILGFSKVELLRKHLSRMFSLIK 1 M NR SRG+ VRGEILGF K E LRKHL RMFSLIK Sbjct: 15 MINRDSRGHSYFIVRGEILGFMKDEQLRKHLPRMFSLIK 53 >ref|XP_002488959.1| hypothetical protein SORBIDRAFT_1180s002020 [Sorghum bicolor] gi|241947001|gb|EES20146.1| hypothetical protein SORBIDRAFT_1180s002020 [Sorghum bicolor] Length = 69 Score = 53.1 bits (126), Expect = 4e-07 Identities = 28/39 (71%), Positives = 29/39 (74%) Frame = -1 Query: 117 MFNRISRGYPNLEVRGEILGFSKVELLRKHLSRMFSLIK 1 M NR SRG+ VRGEILGF K E LRKHL RMFSLIK Sbjct: 1 MINRDSRGHSYFIVRGEILGFMKDEQLRKHLPRMFSLIK 39 >ref|XP_002449484.1| hypothetical protein SORBIDRAFT_05g016450 [Sorghum bicolor] Length = 52 Score = 50.1 bits (118), Expect = 4e-06 Identities = 27/39 (69%), Positives = 28/39 (71%) Frame = -1 Query: 117 MFNRISRGYPNLEVRGEILGFSKVELLRKHLSRMFSLIK 1 M NR S G+ VRGEILGF K E LRKHL RMFSLIK Sbjct: 1 MINRDSWGHSYFIVRGEILGFMKDEQLRKHLPRMFSLIK 39 >gb|EMS62447.1| hypothetical protein TRIUR3_00139 [Triticum urartu] Length = 52 Score = 49.7 bits (117), Expect = 5e-06 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = -1 Query: 117 MFNRISRGYPNLEVRGEILGFSKVELLRKHLSRMFSLIK 1 M NR SRG+ V+GEILGF K E LRKHL RMFSLI+ Sbjct: 1 MINRDSRGHLYFIVKGEILGFMKDEQLRKHLPRMFSLIQ 39 >ref|XP_012850107.1| PREDICTED: uncharacterized protein LOC105969879 [Erythranthe guttata] Length = 829 Score = 53.1 bits (126), Expect = 8e-06 Identities = 28/39 (71%), Positives = 29/39 (74%) Frame = -1 Query: 117 MFNRISRGYPNLEVRGEILGFSKVELLRKHLSRMFSLIK 1 M NR SRG+ VRGEILGF K E LRKHL RMFSLIK Sbjct: 1 MINRDSRGHSYFIVRGEILGFMKDEQLRKHLPRMFSLIK 39