BLASTX nr result
ID: Rehmannia28_contig00051095
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00051095 (414 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011100104.1| PREDICTED: uncharacterized protein LOC105178... 100 3e-23 gb|EYU44552.1| hypothetical protein MIMGU_mgv1a010377mg [Erythra... 64 1e-09 >ref|XP_011100104.1| PREDICTED: uncharacterized protein LOC105178335 [Sesamum indicum] Length = 275 Score = 100 bits (249), Expect = 3e-23 Identities = 47/73 (64%), Positives = 58/73 (79%) Frame = -3 Query: 403 TAAGHAVYRVPAVVSGGVYRTGPYAYGVVPDMGNGNREQPVYNIVPVMPSMPEQRMMVST 224 TAA +YRVPA+V+GGV+++ YAYG+ P MG GN EQP YNI+PVM S+PEQRMM+ Sbjct: 203 TAAAQEIYRVPAMVNGGVHQSVLYAYGIGPAMGRGNLEQPAYNIIPVMASVPEQRMMIPA 262 Query: 223 ENSLEVKGNQRNF 185 +SLEVK NQRNF Sbjct: 263 GSSLEVKVNQRNF 275 >gb|EYU44552.1| hypothetical protein MIMGU_mgv1a010377mg [Erythranthe guttata] Length = 314 Score = 64.3 bits (155), Expect = 1e-09 Identities = 38/68 (55%), Positives = 45/68 (66%), Gaps = 1/68 (1%) Frame = -3 Query: 388 AVYRVPAVVSGG-VYRTGPYAYGVVPDMGNGNREQPVYNIVPVMPSMPEQRMMVSTENSL 212 A+YR P VV+GG +YRTG YAYGVVP + GNREQPVY+ VPV+ S +QR Sbjct: 260 AIYRGPVVVNGGGMYRTGNYAYGVVPAIVTGNREQPVYSFVPVIQS--DQR--------- 308 Query: 211 EVKGNQRN 188 K NQRN Sbjct: 309 --KVNQRN 314