BLASTX nr result
ID: Rehmannia28_contig00050864
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00050864 (653 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ETE73703.1| hypothetical protein L345_00440, partial [Ophioph... 53 9e-06 >gb|ETE73703.1| hypothetical protein L345_00440, partial [Ophiophagus hannah] Length = 111 Score = 52.8 bits (125), Expect = 9e-06 Identities = 24/58 (41%), Positives = 27/58 (46%), Gaps = 2/58 (3%) Frame = +3 Query: 261 WYRVRRIWRWDERWSRCCDWRWSHGWCDWRWSHRWCE-WQW-RQWLFCRLQSWWCVWR 428 W+ WR RW R WRW W WR S RWC W+W W +C W C WR Sbjct: 51 WWTCAWHWRNPRRW-RSPSWRWRPSW-RWRSSWRWCSSWRWCSSWRWCCAWRWCCAWR 106