BLASTX nr result
ID: Rehmannia28_contig00050752
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00050752 (545 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011085992.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYP... 96 7e-22 emb|CBI30686.3| unnamed protein product [Vitis vinifera] 95 8e-22 emb|CAN72178.1| hypothetical protein VITISV_012478 [Vitis vinifera] 95 1e-21 ref|XP_010655519.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYP... 95 1e-21 ref|XP_011101384.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYP... 95 2e-21 ref|XP_002522583.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYP... 95 2e-21 ref|XP_012455239.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYP... 95 2e-21 ref|XP_012091774.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYP... 95 2e-21 ref|XP_012447947.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYP... 95 3e-21 ref|XP_006467647.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYP... 95 4e-21 ref|XP_006449503.1| hypothetical protein CICLE_v10016772mg [Citr... 95 4e-21 gb|EYU28084.1| hypothetical protein MIMGU_mgv1a022457mg [Erythra... 94 4e-21 ref|XP_012849012.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYP... 94 6e-21 ref|XP_008465553.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYP... 94 7e-21 gb|KYP50386.1| hypothetical protein KK1_027863 [Cajanus cajan] 92 7e-21 ref|XP_011657745.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYP... 94 8e-21 ref|XP_008371461.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYP... 94 8e-21 ref|XP_008225289.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYP... 94 8e-21 ref|XP_007212120.1| hypothetical protein PRUPE_ppa012018mg [Prun... 94 8e-21 ref|XP_008358651.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYP... 94 8e-21 >ref|XP_011085992.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Sesamum indicum] Length = 175 Score = 95.9 bits (237), Expect = 7e-22 Identities = 45/48 (93%), Positives = 47/48 (97%) Frame = +2 Query: 2 LDALIGRLRAAYEEHGGSPETNPFGNGAIRVYLREVRDTQAMARGIPY 145 LDALIGRLRAAYEEHGGSPETNPFGNGAIRVYLREV+D+QA ARGIPY Sbjct: 101 LDALIGRLRAAYEEHGGSPETNPFGNGAIRVYLREVKDSQAKARGIPY 148 >emb|CBI30686.3| unnamed protein product [Vitis vinifera] Length = 149 Score = 95.1 bits (235), Expect = 8e-22 Identities = 45/48 (93%), Positives = 46/48 (95%) Frame = +2 Query: 2 LDALIGRLRAAYEEHGGSPETNPFGNGAIRVYLREVRDTQAMARGIPY 145 LDALIGRLRAAYEEHGGSPETNPFGNGAIRVYLREVRD Q+ ARGIPY Sbjct: 79 LDALIGRLRAAYEEHGGSPETNPFGNGAIRVYLREVRDCQSKARGIPY 126 >emb|CAN72178.1| hypothetical protein VITISV_012478 [Vitis vinifera] Length = 175 Score = 95.1 bits (235), Expect = 1e-21 Identities = 45/48 (93%), Positives = 46/48 (95%) Frame = +2 Query: 2 LDALIGRLRAAYEEHGGSPETNPFGNGAIRVYLREVRDTQAMARGIPY 145 LDALIGRLRAAYEEHGGSPETNPFGNGAIRVYLREVRD Q+ ARGIPY Sbjct: 105 LDALIGRLRAAYEEHGGSPETNPFGNGAIRVYLREVRDCQSKARGIPY 152 >ref|XP_010655519.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10 [Vitis vinifera] gi|731404685|ref|XP_010655520.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10 [Vitis vinifera] Length = 175 Score = 95.1 bits (235), Expect = 1e-21 Identities = 45/48 (93%), Positives = 46/48 (95%) Frame = +2 Query: 2 LDALIGRLRAAYEEHGGSPETNPFGNGAIRVYLREVRDTQAMARGIPY 145 LDALIGRLRAAYEEHGGSPETNPFGNGAIRVYLREVRD Q+ ARGIPY Sbjct: 105 LDALIGRLRAAYEEHGGSPETNPFGNGAIRVYLREVRDCQSKARGIPY 152 >ref|XP_011101384.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Sesamum indicum] Length = 183 Score = 95.1 bits (235), Expect = 2e-21 Identities = 45/48 (93%), Positives = 46/48 (95%) Frame = +2 Query: 2 LDALIGRLRAAYEEHGGSPETNPFGNGAIRVYLREVRDTQAMARGIPY 145 LDALIGRLRAAYEEHGGSPETNPFGNGAIRVYLREV+D QA ARGIPY Sbjct: 110 LDALIGRLRAAYEEHGGSPETNPFGNGAIRVYLREVKDCQAKARGIPY 157 >ref|XP_002522583.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10 [Ricinus communis] gi|223538274|gb|EEF39883.1| conserved hypothetical protein [Ricinus communis] Length = 180 Score = 94.7 bits (234), Expect = 2e-21 Identities = 45/48 (93%), Positives = 46/48 (95%) Frame = +2 Query: 2 LDALIGRLRAAYEEHGGSPETNPFGNGAIRVYLREVRDTQAMARGIPY 145 LDALIGRLRAAYEEHGGSPETNPFGNGAIRVYLREVR+ QA ARGIPY Sbjct: 108 LDALIGRLRAAYEEHGGSPETNPFGNGAIRVYLREVRECQAKARGIPY 155 >ref|XP_012455239.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10 [Gossypium raimondii] gi|763802799|gb|KJB69737.1| hypothetical protein B456_011G039700 [Gossypium raimondii] Length = 182 Score = 94.7 bits (234), Expect = 2e-21 Identities = 45/48 (93%), Positives = 46/48 (95%) Frame = +2 Query: 2 LDALIGRLRAAYEEHGGSPETNPFGNGAIRVYLREVRDTQAMARGIPY 145 LDALIGRLRAAYEEHGGSPETNPFGNGAIRVYLREVR+ QA ARGIPY Sbjct: 107 LDALIGRLRAAYEEHGGSPETNPFGNGAIRVYLREVRECQAKARGIPY 154 >ref|XP_012091774.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10 [Jatropha curcas] gi|643704032|gb|KDP21096.1| hypothetical protein JCGZ_21567 [Jatropha curcas] Length = 182 Score = 94.7 bits (234), Expect = 2e-21 Identities = 45/48 (93%), Positives = 46/48 (95%) Frame = +2 Query: 2 LDALIGRLRAAYEEHGGSPETNPFGNGAIRVYLREVRDTQAMARGIPY 145 LDALIGRLRAAYEEHGGSPETNPFGNGAIRVYLREVR+ QA ARGIPY Sbjct: 111 LDALIGRLRAAYEEHGGSPETNPFGNGAIRVYLREVRECQAKARGIPY 158 >ref|XP_012447947.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Gossypium raimondii] gi|763790407|gb|KJB57403.1| hypothetical protein B456_009G162300 [Gossypium raimondii] Length = 208 Score = 95.1 bits (235), Expect = 3e-21 Identities = 45/48 (93%), Positives = 46/48 (95%) Frame = +2 Query: 2 LDALIGRLRAAYEEHGGSPETNPFGNGAIRVYLREVRDTQAMARGIPY 145 LDALIGRLRAAY+EHGGSPETNPFGNGAIRVYLREVRD QA ARGIPY Sbjct: 130 LDALIGRLRAAYDEHGGSPETNPFGNGAIRVYLREVRDCQAKARGIPY 177 >ref|XP_006467647.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10 [Citrus sinensis] gi|641859171|gb|KDO77861.1| hypothetical protein CISIN_1g029090mg [Citrus sinensis] Length = 199 Score = 94.7 bits (234), Expect = 4e-21 Identities = 45/48 (93%), Positives = 46/48 (95%) Frame = +2 Query: 2 LDALIGRLRAAYEEHGGSPETNPFGNGAIRVYLREVRDTQAMARGIPY 145 LDALIGRLRAAYEEHGGSPETNPFGNGAIRVYLREVR+ QA ARGIPY Sbjct: 126 LDALIGRLRAAYEEHGGSPETNPFGNGAIRVYLREVRECQAKARGIPY 173 >ref|XP_006449503.1| hypothetical protein CICLE_v10016772mg [Citrus clementina] gi|567914381|ref|XP_006449504.1| hypothetical protein CICLE_v10016772mg [Citrus clementina] gi|557552114|gb|ESR62743.1| hypothetical protein CICLE_v10016772mg [Citrus clementina] gi|557552115|gb|ESR62744.1| hypothetical protein CICLE_v10016772mg [Citrus clementina] Length = 199 Score = 94.7 bits (234), Expect = 4e-21 Identities = 45/48 (93%), Positives = 46/48 (95%) Frame = +2 Query: 2 LDALIGRLRAAYEEHGGSPETNPFGNGAIRVYLREVRDTQAMARGIPY 145 LDALIGRLRAAYEEHGGSPETNPFGNGAIRVYLREVR+ QA ARGIPY Sbjct: 126 LDALIGRLRAAYEEHGGSPETNPFGNGAIRVYLREVRECQAKARGIPY 173 >gb|EYU28084.1| hypothetical protein MIMGU_mgv1a022457mg [Erythranthe guttata] Length = 176 Score = 94.0 bits (232), Expect = 4e-21 Identities = 44/48 (91%), Positives = 46/48 (95%) Frame = +2 Query: 2 LDALIGRLRAAYEEHGGSPETNPFGNGAIRVYLREVRDTQAMARGIPY 145 LDALIGRLRAAYEEHGGSPETNPFGNG+IRVYLREV+D QA ARGIPY Sbjct: 99 LDALIGRLRAAYEEHGGSPETNPFGNGSIRVYLREVKDCQAKARGIPY 146 >ref|XP_012849012.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Erythranthe guttata] Length = 187 Score = 94.0 bits (232), Expect = 6e-21 Identities = 44/48 (91%), Positives = 46/48 (95%) Frame = +2 Query: 2 LDALIGRLRAAYEEHGGSPETNPFGNGAIRVYLREVRDTQAMARGIPY 145 LDALIGRLRAAYEEHGGSPETNPFGNG+IRVYLREV+D QA ARGIPY Sbjct: 110 LDALIGRLRAAYEEHGGSPETNPFGNGSIRVYLREVKDCQAKARGIPY 157 >ref|XP_008465553.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Cucumis melo] Length = 182 Score = 93.6 bits (231), Expect = 7e-21 Identities = 44/48 (91%), Positives = 46/48 (95%) Frame = +2 Query: 2 LDALIGRLRAAYEEHGGSPETNPFGNGAIRVYLREVRDTQAMARGIPY 145 LDALIGRLRAAYEEHGGSPETNPFGNGAIRVYLREV++ QA ARGIPY Sbjct: 104 LDALIGRLRAAYEEHGGSPETNPFGNGAIRVYLREVKECQAKARGIPY 151 >gb|KYP50386.1| hypothetical protein KK1_027863 [Cajanus cajan] Length = 118 Score = 91.7 bits (226), Expect = 7e-21 Identities = 43/48 (89%), Positives = 46/48 (95%) Frame = +2 Query: 2 LDALIGRLRAAYEEHGGSPETNPFGNGAIRVYLREVRDTQAMARGIPY 145 LDALIGRLRAAYEEHGGSPETNPFG+GAIRVYLREV++ QA ARGIPY Sbjct: 44 LDALIGRLRAAYEEHGGSPETNPFGSGAIRVYLREVKECQAKARGIPY 91 >ref|XP_011657745.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Cucumis sativus] gi|700210540|gb|KGN65636.1| hypothetical protein Csa_1G474480 [Cucumis sativus] Length = 186 Score = 93.6 bits (231), Expect = 8e-21 Identities = 44/48 (91%), Positives = 46/48 (95%) Frame = +2 Query: 2 LDALIGRLRAAYEEHGGSPETNPFGNGAIRVYLREVRDTQAMARGIPY 145 LDALIGRLRAAYEEHGGSPETNPFGNGAIRVYLREV++ QA ARGIPY Sbjct: 103 LDALIGRLRAAYEEHGGSPETNPFGNGAIRVYLREVKECQAKARGIPY 150 >ref|XP_008371461.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Malus domestica] gi|657959818|ref|XP_008371462.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Malus domestica] gi|694310068|ref|XP_009349575.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Pyrus x bretschneideri] gi|694310071|ref|XP_009349639.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Pyrus x bretschneideri] Length = 187 Score = 93.6 bits (231), Expect = 8e-21 Identities = 44/48 (91%), Positives = 46/48 (95%) Frame = +2 Query: 2 LDALIGRLRAAYEEHGGSPETNPFGNGAIRVYLREVRDTQAMARGIPY 145 LDALIGRLRAAYEEHGGSPETNPFGNGAIRVYLREV++ QA ARGIPY Sbjct: 117 LDALIGRLRAAYEEHGGSPETNPFGNGAIRVYLREVKECQAKARGIPY 164 >ref|XP_008225289.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Prunus mume] Length = 187 Score = 93.6 bits (231), Expect = 8e-21 Identities = 44/48 (91%), Positives = 46/48 (95%) Frame = +2 Query: 2 LDALIGRLRAAYEEHGGSPETNPFGNGAIRVYLREVRDTQAMARGIPY 145 LDALIGRLRAAYEEHGGSPETNPFGNGAIRVYLREV++ QA ARGIPY Sbjct: 113 LDALIGRLRAAYEEHGGSPETNPFGNGAIRVYLREVKECQAKARGIPY 160 >ref|XP_007212120.1| hypothetical protein PRUPE_ppa012018mg [Prunus persica] gi|462407985|gb|EMJ13319.1| hypothetical protein PRUPE_ppa012018mg [Prunus persica] Length = 187 Score = 93.6 bits (231), Expect = 8e-21 Identities = 44/48 (91%), Positives = 46/48 (95%) Frame = +2 Query: 2 LDALIGRLRAAYEEHGGSPETNPFGNGAIRVYLREVRDTQAMARGIPY 145 LDALIGRLRAAYEEHGGSPETNPFGNGAIRVYLREV++ QA ARGIPY Sbjct: 113 LDALIGRLRAAYEEHGGSPETNPFGNGAIRVYLREVKECQAKARGIPY 160 >ref|XP_008358651.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Malus domestica] gi|694323398|ref|XP_009352770.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Pyrus x bretschneideri] Length = 190 Score = 93.6 bits (231), Expect = 8e-21 Identities = 44/48 (91%), Positives = 46/48 (95%) Frame = +2 Query: 2 LDALIGRLRAAYEEHGGSPETNPFGNGAIRVYLREVRDTQAMARGIPY 145 LDALIGRLRAAYEEHGGSPETNPFGNGAIRVYLREV++ QA ARGIPY Sbjct: 117 LDALIGRLRAAYEEHGGSPETNPFGNGAIRVYLREVKECQAKARGIPY 164