BLASTX nr result
ID: Rehmannia28_contig00050471
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00050471 (383 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011097880.1| PREDICTED: NEP1-interacting protein 1-like [... 95 8e-22 ref|XP_012841649.1| PREDICTED: NEP1-interacting protein-like 2 [... 90 6e-20 gb|EYU33642.1| hypothetical protein MIMGU_mgv1a018571mg [Erythra... 90 8e-20 ref|XP_012827587.1| PREDICTED: NEP1-interacting protein 2-like [... 89 2e-19 ref|XP_011095396.1| PREDICTED: NEP1-interacting protein-like 1 [... 88 4e-19 gb|KVI10342.1| Zinc finger, RING/FYVE/PHD-type [Cynara carduncul... 86 3e-18 ref|XP_006365957.1| PREDICTED: NEP1-interacting protein-like 1 [... 83 5e-17 ref|XP_009625947.1| PREDICTED: NEP1-interacting protein-like 1 [... 82 6e-17 ref|XP_009763476.1| PREDICTED: NEP1-interacting protein-like 1 [... 82 1e-16 ref|XP_015059758.1| PREDICTED: NEP1-interacting protein-like 1 [... 81 2e-16 ref|XP_004251461.1| PREDICTED: NEP1-interacting protein-like 1 [... 81 2e-16 ref|XP_010240881.1| PREDICTED: NEP1-interacting protein 1-like [... 81 2e-16 ref|XP_007020828.1| RING/U-box superfamily protein, putative iso... 80 6e-16 ref|XP_007020829.1| RING/U-box superfamily protein, putative iso... 80 6e-16 ref|XP_007020830.1| RING/U-box superfamily protein, putative iso... 80 9e-16 gb|KJB81735.1| hypothetical protein B456_013G159600 [Gossypium r... 78 1e-15 emb|CDP05757.1| unnamed protein product [Coffea canephora] 78 1e-15 ref|XP_010273180.1| PREDICTED: uncharacterized protein LOC104608... 81 1e-15 gb|KHG16069.1| NEP1-interacting 1 -like protein [Gossypium arbor... 79 2e-15 gb|KJB81737.1| hypothetical protein B456_013G159600 [Gossypium r... 78 3e-15 >ref|XP_011097880.1| PREDICTED: NEP1-interacting protein 1-like [Sesamum indicum] Length = 223 Score = 95.1 bits (235), Expect = 8e-22 Identities = 39/49 (79%), Positives = 43/49 (87%) Frame = -1 Query: 383 ETTCAICLQDLKDGEYVRLLSNCKHFYHLHCIDEWLIRQGTCPICRKDV 237 E TCAICLQDL+DGE RLL +CKHF+HLHCID+WL RQG CPICRKDV Sbjct: 175 EATCAICLQDLEDGESARLLPSCKHFFHLHCIDQWLTRQGNCPICRKDV 223 >ref|XP_012841649.1| PREDICTED: NEP1-interacting protein-like 2 [Erythranthe guttata] Length = 202 Score = 89.7 bits (221), Expect = 6e-20 Identities = 39/49 (79%), Positives = 40/49 (81%) Frame = -1 Query: 383 ETTCAICLQDLKDGEYVRLLSNCKHFYHLHCIDEWLIRQGTCPICRKDV 237 ET+C ICLQDLKDGE VR L NCKH YHL CIDEWL RQG CPICRK V Sbjct: 154 ETSCPICLQDLKDGEAVRFLPNCKHLYHLCCIDEWLSRQGNCPICRKRV 202 >gb|EYU33642.1| hypothetical protein MIMGU_mgv1a018571mg [Erythranthe guttata] Length = 214 Score = 89.7 bits (221), Expect = 8e-20 Identities = 39/49 (79%), Positives = 40/49 (81%) Frame = -1 Query: 383 ETTCAICLQDLKDGEYVRLLSNCKHFYHLHCIDEWLIRQGTCPICRKDV 237 ET+C ICLQDLKDGE VR L NCKH YHL CIDEWL RQG CPICRK V Sbjct: 166 ETSCPICLQDLKDGEAVRFLPNCKHLYHLCCIDEWLSRQGNCPICRKRV 214 >ref|XP_012827587.1| PREDICTED: NEP1-interacting protein 2-like [Erythranthe guttata] gi|604299325|gb|EYU19260.1| hypothetical protein MIMGU_mgv1a013420mg [Erythranthe guttata] Length = 221 Score = 88.6 bits (218), Expect = 2e-19 Identities = 36/47 (76%), Positives = 41/47 (87%) Frame = -1 Query: 377 TCAICLQDLKDGEYVRLLSNCKHFYHLHCIDEWLIRQGTCPICRKDV 237 +CAICLQDLKD E RLL +C+H +HLHCIDEWL RQGTCP+CRKDV Sbjct: 175 SCAICLQDLKDRESTRLLPSCRHLFHLHCIDEWLARQGTCPMCRKDV 221 >ref|XP_011095396.1| PREDICTED: NEP1-interacting protein-like 1 [Sesamum indicum] Length = 223 Score = 88.2 bits (217), Expect = 4e-19 Identities = 35/49 (71%), Positives = 41/49 (83%) Frame = -1 Query: 383 ETTCAICLQDLKDGEYVRLLSNCKHFYHLHCIDEWLIRQGTCPICRKDV 237 +T C ICLQD K+GE RLL +C+HF+HLHCIDEWL RQ +CPICRKDV Sbjct: 175 DTCCTICLQDFKNGECTRLLPSCRHFFHLHCIDEWLTRQASCPICRKDV 223 >gb|KVI10342.1| Zinc finger, RING/FYVE/PHD-type [Cynara cardunculus var. scolymus] Length = 231 Score = 85.9 bits (211), Expect = 3e-18 Identities = 36/49 (73%), Positives = 41/49 (83%) Frame = -1 Query: 383 ETTCAICLQDLKDGEYVRLLSNCKHFYHLHCIDEWLIRQGTCPICRKDV 237 ET+C ICLQD K+GE R L NC+H +HL CIDEWLIRQG+CPICRKDV Sbjct: 183 ETSCTICLQDFKNGEEGRELLNCRHVFHLKCIDEWLIRQGSCPICRKDV 231 >ref|XP_006365957.1| PREDICTED: NEP1-interacting protein-like 1 [Solanum tuberosum] Length = 228 Score = 82.8 bits (203), Expect = 5e-17 Identities = 32/49 (65%), Positives = 40/49 (81%) Frame = -1 Query: 383 ETTCAICLQDLKDGEYVRLLSNCKHFYHLHCIDEWLIRQGTCPICRKDV 237 E TCAICLQD KDG+ R+L +CKH +H CIDEWLIR G+CPICR+++ Sbjct: 180 EVTCAICLQDFKDGDSARVLPSCKHSFHTQCIDEWLIRHGSCPICREEI 228 >ref|XP_009625947.1| PREDICTED: NEP1-interacting protein-like 1 [Nicotiana tomentosiformis] Length = 228 Score = 82.4 bits (202), Expect = 6e-17 Identities = 33/49 (67%), Positives = 39/49 (79%) Frame = -1 Query: 383 ETTCAICLQDLKDGEYVRLLSNCKHFYHLHCIDEWLIRQGTCPICRKDV 237 E TCAICLQD KDG+ RLL +CKH +H CIDEWLIR G+CPICR ++ Sbjct: 180 EVTCAICLQDFKDGDSARLLPSCKHNFHTQCIDEWLIRHGSCPICRVEI 228 >ref|XP_009763476.1| PREDICTED: NEP1-interacting protein-like 1 [Nicotiana sylvestris] Length = 228 Score = 81.6 bits (200), Expect = 1e-16 Identities = 32/49 (65%), Positives = 39/49 (79%) Frame = -1 Query: 383 ETTCAICLQDLKDGEYVRLLSNCKHFYHLHCIDEWLIRQGTCPICRKDV 237 E TC+ICLQD KDG+ RLL +CKH +H CIDEWLIR G+CPICR ++ Sbjct: 180 EVTCSICLQDFKDGDSARLLPSCKHSFHTQCIDEWLIRHGSCPICRVEI 228 >ref|XP_015059758.1| PREDICTED: NEP1-interacting protein-like 1 [Solanum pennellii] Length = 223 Score = 81.3 bits (199), Expect = 2e-16 Identities = 32/49 (65%), Positives = 39/49 (79%) Frame = -1 Query: 383 ETTCAICLQDLKDGEYVRLLSNCKHFYHLHCIDEWLIRQGTCPICRKDV 237 + TCAICLQDLKDGE R+L +CKH +H CIDEWL R G+CPICR ++ Sbjct: 175 QVTCAICLQDLKDGESARVLPSCKHSFHTQCIDEWLTRHGSCPICRVEI 223 >ref|XP_004251461.1| PREDICTED: NEP1-interacting protein-like 1 [Solanum lycopersicum] Length = 223 Score = 81.3 bits (199), Expect = 2e-16 Identities = 32/49 (65%), Positives = 39/49 (79%) Frame = -1 Query: 383 ETTCAICLQDLKDGEYVRLLSNCKHFYHLHCIDEWLIRQGTCPICRKDV 237 + TCAICLQDLKDGE R+L +CKH +H CIDEWL R G+CPICR ++ Sbjct: 175 QVTCAICLQDLKDGESARVLPSCKHSFHTQCIDEWLTRHGSCPICRVEI 223 >ref|XP_010240881.1| PREDICTED: NEP1-interacting protein 1-like [Nelumbo nucifera] Length = 211 Score = 80.9 bits (198), Expect = 2e-16 Identities = 31/49 (63%), Positives = 39/49 (79%) Frame = -1 Query: 383 ETTCAICLQDLKDGEYVRLLSNCKHFYHLHCIDEWLIRQGTCPICRKDV 237 E C ICLQD K+G+ R L NC+HF+HL CID+WL+R G+CPICR+DV Sbjct: 163 EMCCTICLQDFKEGDSARRLPNCRHFFHLLCIDQWLVRHGSCPICRQDV 211 >ref|XP_007020828.1| RING/U-box superfamily protein, putative isoform 1 [Theobroma cacao] gi|508720456|gb|EOY12353.1| RING/U-box superfamily protein, putative isoform 1 [Theobroma cacao] Length = 235 Score = 80.1 bits (196), Expect = 6e-16 Identities = 32/49 (65%), Positives = 40/49 (81%) Frame = -1 Query: 383 ETTCAICLQDLKDGEYVRLLSNCKHFYHLHCIDEWLIRQGTCPICRKDV 237 E++C+ICLQ+LKDGE R L C H +HL+CIDEWL RQGTCP+CR+ V Sbjct: 180 ESSCSICLQELKDGELARNLPRCGHIFHLNCIDEWLSRQGTCPMCREQV 228 >ref|XP_007020829.1| RING/U-box superfamily protein, putative isoform 2 [Theobroma cacao] gi|508720457|gb|EOY12354.1| RING/U-box superfamily protein, putative isoform 2 [Theobroma cacao] Length = 239 Score = 80.1 bits (196), Expect = 6e-16 Identities = 32/49 (65%), Positives = 40/49 (81%) Frame = -1 Query: 383 ETTCAICLQDLKDGEYVRLLSNCKHFYHLHCIDEWLIRQGTCPICRKDV 237 E++C+ICLQ+LKDGE R L C H +HL+CIDEWL RQGTCP+CR+ V Sbjct: 184 ESSCSICLQELKDGELARNLPRCGHIFHLNCIDEWLSRQGTCPMCREQV 232 >ref|XP_007020830.1| RING/U-box superfamily protein, putative isoform 3 [Theobroma cacao] gi|508720458|gb|EOY12355.1| RING/U-box superfamily protein, putative isoform 3 [Theobroma cacao] Length = 270 Score = 80.1 bits (196), Expect = 9e-16 Identities = 32/49 (65%), Positives = 40/49 (81%) Frame = -1 Query: 383 ETTCAICLQDLKDGEYVRLLSNCKHFYHLHCIDEWLIRQGTCPICRKDV 237 E++C+ICLQ+LKDGE R L C H +HL+CIDEWL RQGTCP+CR+ V Sbjct: 215 ESSCSICLQELKDGELARNLPRCGHIFHLNCIDEWLSRQGTCPMCREQV 263 >gb|KJB81735.1| hypothetical protein B456_013G159600 [Gossypium raimondii] gi|763814886|gb|KJB81738.1| hypothetical protein B456_013G159600 [Gossypium raimondii] Length = 171 Score = 77.8 bits (190), Expect = 1e-15 Identities = 35/61 (57%), Positives = 43/61 (70%) Frame = -1 Query: 383 ETTCAICLQDLKDGEYVRLLSNCKHFYHLHCIDEWLIRQGTCPICRKDV*WKQEDGEIEE 204 E+ C+IC+Q LKDGE R L C H +HL CIDEWL RQGTCP+CR+ V DG+ EE Sbjct: 115 ESYCSICIQGLKDGEMARNLPRCGHIFHLKCIDEWLSRQGTCPMCREHV----LDGDGEE 170 Query: 203 I 201 + Sbjct: 171 V 171 >emb|CDP05757.1| unnamed protein product [Coffea canephora] Length = 191 Score = 78.2 bits (191), Expect = 1e-15 Identities = 30/49 (61%), Positives = 38/49 (77%) Frame = -1 Query: 383 ETTCAICLQDLKDGEYVRLLSNCKHFYHLHCIDEWLIRQGTCPICRKDV 237 ET CAICL D K+G+ R+L C H +HL+CIDEWL R GTCP+CR+D+ Sbjct: 143 ETICAICLTDFKNGDCARMLPTCGHSFHLNCIDEWLNRNGTCPVCRRDI 191 >ref|XP_010273180.1| PREDICTED: uncharacterized protein LOC104608799 [Nelumbo nucifera] Length = 403 Score = 80.9 bits (198), Expect = 1e-15 Identities = 31/49 (63%), Positives = 39/49 (79%) Frame = -1 Query: 383 ETTCAICLQDLKDGEYVRLLSNCKHFYHLHCIDEWLIRQGTCPICRKDV 237 E +C ICLQD K+G++ R L NC+HF+HL CID WL+R G+CPICR DV Sbjct: 355 ERSCTICLQDFKEGDHARKLPNCRHFFHLLCIDGWLVRHGSCPICRTDV 403 >gb|KHG16069.1| NEP1-interacting 1 -like protein [Gossypium arboreum] gi|728839336|gb|KHG18779.1| NEP1-interacting 1 -like protein [Gossypium arboreum] Length = 244 Score = 78.6 bits (192), Expect = 2e-15 Identities = 32/49 (65%), Positives = 38/49 (77%) Frame = -1 Query: 383 ETTCAICLQDLKDGEYVRLLSNCKHFYHLHCIDEWLIRQGTCPICRKDV 237 E+ C+IC+Q LKDGE R L C H +HL CIDEWL RQGTCP+CR+DV Sbjct: 177 ESYCSICIQGLKDGEMARNLPRCGHIFHLKCIDEWLSRQGTCPMCREDV 225 >gb|KJB81737.1| hypothetical protein B456_013G159600 [Gossypium raimondii] Length = 221 Score = 77.8 bits (190), Expect = 3e-15 Identities = 35/61 (57%), Positives = 43/61 (70%) Frame = -1 Query: 383 ETTCAICLQDLKDGEYVRLLSNCKHFYHLHCIDEWLIRQGTCPICRKDV*WKQEDGEIEE 204 E+ C+IC+Q LKDGE R L C H +HL CIDEWL RQGTCP+CR+ V DG+ EE Sbjct: 165 ESYCSICIQGLKDGEMARNLPRCGHIFHLKCIDEWLSRQGTCPMCREHV----LDGDGEE 220 Query: 203 I 201 + Sbjct: 221 V 221