BLASTX nr result
ID: Rehmannia28_contig00050340
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00050340 (392 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012185447.1| predicted protein [Fibroporia radiculosa] gi... 70 8e-14 gb|EME38016.1| hypothetical protein DOTSEDRAFT_101619, partial [... 59 2e-09 gb|KYG40184.1| hypothetical protein M433DRAFT_29086, partial [Ac... 59 2e-09 ref|XP_007682037.1| hypothetical protein BAUCODRAFT_57269, parti... 59 2e-09 gb|KYG39741.1| hypothetical protein M433DRAFT_47351, partial [Ac... 59 2e-09 ref|XP_003851049.1| hypothetical protein MYCGRDRAFT_45572, parti... 59 3e-09 gb|ADI72904.1| hypothetical protein, partial [Ophiocordyceps uni... 59 3e-09 gb|KIM19404.1| hypothetical protein M408DRAFT_231258 [Serendipit... 59 3e-09 gb|KIM92488.1| hypothetical protein OIDMADRAFT_139572, partial [... 59 3e-09 ref|XP_011116925.1| hypothetical protein H072_8238 [Dactylellina... 59 4e-09 gb|EQL27843.1| hypothetical protein BDFG_09352 [Blastomyces derm... 59 5e-09 gb|EMD31866.1| hypothetical protein CERSUDRAFT_162690 [Gelatopor... 59 9e-09 gb|EHA21130.1| hypothetical protein ASPNIDRAFT_195725 [Aspergill... 57 1e-08 gb|KYP30978.1| hypothetical protein KK1_049375 [Cajanus cajan] 59 3e-08 ref|XP_710281.1| hypothetical protein CaO19.6835 [Candida albica... 55 4e-08 ref|XP_002477792.1| predicted protein [Postia placenta Mad-698-R... 55 5e-08 gb|EJU02318.1| hypothetical protein DACRYDRAFT_51410, partial [D... 55 5e-08 ref|XP_001617522.1| hypothetical protein NEMVEDRAFT_v1g157418 [N... 55 6e-08 gb|KIK72365.1| hypothetical protein PAXRUDRAFT_47302, partial [P... 55 6e-08 gb|KIN97676.1| hypothetical protein M404DRAFT_159840, partial [P... 55 6e-08 >ref|XP_012185447.1| predicted protein [Fibroporia radiculosa] gi|403419464|emb|CCM06164.1| predicted protein [Fibroporia radiculosa] Length = 71 Score = 70.5 bits (171), Expect = 8e-14 Identities = 43/80 (53%), Positives = 46/80 (57%) Frame = -2 Query: 244 RPVLSTRTKESNNLASIRVTNSRCTTNVKPVNPSISWEQQGPE*EHPLYPSKSMYCWDPK 65 RPVL TRTKESN AS+ V +NPS S + CWDPK Sbjct: 5 RPVLETRTKESNIPASVWV-----------LNPSASAVEH--------------VCWDPK 39 Query: 64 DGELCLNRVKPEETLVEARS 5 DGELCLNRVKPEETLVEARS Sbjct: 40 DGELCLNRVKPEETLVEARS 59 >gb|EME38016.1| hypothetical protein DOTSEDRAFT_101619, partial [Dothistroma septosporum NZE10] Length = 54 Score = 58.9 bits (141), Expect = 2e-09 Identities = 24/25 (96%), Positives = 25/25 (100%) Frame = +1 Query: 7 CEPPPEFPLASPYSGIVHHLSGPNN 81 CEPPPEFPLASPYSGIVHHLSGPN+ Sbjct: 18 CEPPPEFPLASPYSGIVHHLSGPNS 42 >gb|KYG40184.1| hypothetical protein M433DRAFT_29086, partial [Acidomyces richmondensis BFW] Length = 60 Score = 58.9 bits (141), Expect = 2e-09 Identities = 24/25 (96%), Positives = 25/25 (100%) Frame = +1 Query: 7 CEPPPEFPLASPYSGIVHHLSGPNN 81 CEPPPEFPLASPYSGIVHHLSGPN+ Sbjct: 18 CEPPPEFPLASPYSGIVHHLSGPNS 42 >ref|XP_007682037.1| hypothetical protein BAUCODRAFT_57269, partial [Baudoinia panamericana UAMH 10762] gi|449294786|gb|EMC90812.1| hypothetical protein BAUCODRAFT_57269, partial [Baudoinia panamericana UAMH 10762] Length = 60 Score = 58.9 bits (141), Expect = 2e-09 Identities = 24/25 (96%), Positives = 25/25 (100%) Frame = +1 Query: 7 CEPPPEFPLASPYSGIVHHLSGPNN 81 CEPPPEFPLASPYSGIVHHLSGPN+ Sbjct: 18 CEPPPEFPLASPYSGIVHHLSGPNS 42 >gb|KYG39741.1| hypothetical protein M433DRAFT_47351, partial [Acidomyces richmondensis BFW] gi|1005695381|gb|KYG39749.1| hypothetical protein M433DRAFT_47935, partial [Acidomyces richmondensis BFW] Length = 61 Score = 58.9 bits (141), Expect = 2e-09 Identities = 24/25 (96%), Positives = 25/25 (100%) Frame = +1 Query: 7 CEPPPEFPLASPYSGIVHHLSGPNN 81 CEPPPEFPLASPYSGIVHHLSGPN+ Sbjct: 18 CEPPPEFPLASPYSGIVHHLSGPNS 42 >ref|XP_003851049.1| hypothetical protein MYCGRDRAFT_45572, partial [Zymoseptoria tritici IPO323] gi|398395193|ref|XP_003851055.1| hypothetical protein MYCGRDRAFT_45273, partial [Zymoseptoria tritici IPO323] gi|339470928|gb|EGP86025.1| hypothetical protein MYCGRDRAFT_45572, partial [Zymoseptoria tritici IPO323] gi|339470934|gb|EGP86031.1| hypothetical protein MYCGRDRAFT_45273, partial [Zymoseptoria tritici IPO323] Length = 72 Score = 58.9 bits (141), Expect = 3e-09 Identities = 24/25 (96%), Positives = 25/25 (100%) Frame = +1 Query: 7 CEPPPEFPLASPYSGIVHHLSGPNN 81 CEPPPEFPLASPYSGIVHHLSGPN+ Sbjct: 18 CEPPPEFPLASPYSGIVHHLSGPNS 42 >gb|ADI72904.1| hypothetical protein, partial [Ophiocordyceps unilateralis] Length = 74 Score = 58.9 bits (141), Expect = 3e-09 Identities = 24/25 (96%), Positives = 25/25 (100%) Frame = +1 Query: 7 CEPPPEFPLASPYSGIVHHLSGPNN 81 CEPPPEFPLASPYSGIVHHLSGPN+ Sbjct: 18 CEPPPEFPLASPYSGIVHHLSGPNS 42 >gb|KIM19404.1| hypothetical protein M408DRAFT_231258 [Serendipita vermifera MAFF 305830] Length = 65 Score = 58.5 bits (140), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -2 Query: 79 CWDPKDGELCLNRVKPEETLVEARS 5 CWDPKDGELCLNRVKPEETLVEARS Sbjct: 29 CWDPKDGELCLNRVKPEETLVEARS 53 >gb|KIM92488.1| hypothetical protein OIDMADRAFT_139572, partial [Oidiodendron maius Zn] gi|751758565|gb|KIN06739.1| hypothetical protein OIDMADRAFT_111751, partial [Oidiodendron maius Zn] Length = 81 Score = 58.9 bits (141), Expect = 3e-09 Identities = 24/25 (96%), Positives = 25/25 (100%) Frame = +1 Query: 7 CEPPPEFPLASPYSGIVHHLSGPNN 81 CEPPPEFPLASPYSGIVHHLSGPN+ Sbjct: 18 CEPPPEFPLASPYSGIVHHLSGPNS 42 >ref|XP_011116925.1| hypothetical protein H072_8238 [Dactylellina haptotyla CBS 200.50] gi|526196690|gb|EPS38042.1| hypothetical protein H072_8238 [Dactylellina haptotyla CBS 200.50] Length = 73 Score = 58.5 bits (140), Expect = 4e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -2 Query: 79 CWDPKDGELCLNRVKPEETLVEARS 5 CWDPKDGELCLNRVKPEETLVEARS Sbjct: 29 CWDPKDGELCLNRVKPEETLVEARS 53 >gb|EQL27843.1| hypothetical protein BDFG_09352 [Blastomyces dermatitidis ATCC 26199] Length = 94 Score = 58.9 bits (141), Expect = 5e-09 Identities = 24/25 (96%), Positives = 25/25 (100%) Frame = +1 Query: 7 CEPPPEFPLASPYSGIVHHLSGPNN 81 CEPPPEFPLASPYSGIVHHLSGPN+ Sbjct: 14 CEPPPEFPLASPYSGIVHHLSGPNS 38 >gb|EMD31866.1| hypothetical protein CERSUDRAFT_162690 [Gelatoporia subvermispora B] Length = 108 Score = 58.5 bits (140), Expect = 9e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -2 Query: 79 CWDPKDGELCLNRVKPEETLVEARS 5 CWDPKDGELCLNRVKPEETLVEARS Sbjct: 72 CWDPKDGELCLNRVKPEETLVEARS 96 >gb|EHA21130.1| hypothetical protein ASPNIDRAFT_195725 [Aspergillus niger ATCC 1015] Length = 67 Score = 57.0 bits (136), Expect = 1e-08 Identities = 23/25 (92%), Positives = 25/25 (100%) Frame = +1 Query: 7 CEPPPEFPLASPYSGIVHHLSGPNN 81 CEPPPEFPLASPYSGIVHHLSGP++ Sbjct: 3 CEPPPEFPLASPYSGIVHHLSGPHS 27 >gb|KYP30978.1| hypothetical protein KK1_049375 [Cajanus cajan] Length = 170 Score = 58.5 bits (140), Expect = 3e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -2 Query: 79 CWDPKDGELCLNRVKPEETLVEARS 5 CWDPKDGELCLNRVKPEETLVEARS Sbjct: 29 CWDPKDGELCLNRVKPEETLVEARS 53 >ref|XP_710281.1| hypothetical protein CaO19.6835 [Candida albicans SC5314] gi|46431455|gb|EAK91016.1| hypothetical protein CaO19.6835 [Candida albicans SC5314] Length = 108 Score = 54.7 bits (130), Expect(2) = 4e-08 Identities = 29/40 (72%), Positives = 30/40 (75%) Frame = +3 Query: 6 LRASTRVSSGFTLFRHSSPSFGSQQYMLLLG*RGCSHSGP 125 LRASTRVSSGFTLFRHSSPSFGSQQ CS+S P Sbjct: 22 LRASTRVSSGFTLFRHSSPSFGSQQL--------CSYSNP 53 Score = 29.6 bits (65), Expect(2) = 4e-08 Identities = 14/23 (60%), Positives = 15/23 (65%) Frame = +2 Query: 179 RVCHSNARKIVRLLGPC*QDGSL 247 RV H N R VRLLGPC + G L Sbjct: 78 RVLHPNTRIDVRLLGPCFKTGDL 100 >ref|XP_002477792.1| predicted protein [Postia placenta Mad-698-R] gi|220721945|gb|EED77009.1| predicted protein, partial [Postia placenta Mad-698-R] Length = 60 Score = 55.5 bits (132), Expect = 5e-08 Identities = 27/42 (64%), Positives = 28/42 (66%) Frame = +1 Query: 10 EPPPEFPLASPYSGIVHHLSGPNNTCSYSDREDALTPVPVAP 135 EPPPEFPLASPYSGIVHHLSGPN R + P AP Sbjct: 19 EPPPEFPLASPYSGIVHHLSGPNIHAPPQSRHRSSGPGVDAP 60 >gb|EJU02318.1| hypothetical protein DACRYDRAFT_51410, partial [Dacryopinax sp. DJM-731 SS1] Length = 50 Score = 55.1 bits (131), Expect = 5e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +1 Query: 10 EPPPEFPLASPYSGIVHHLSGPN 78 EPPPEFPLASPYSGIVHHLSGPN Sbjct: 19 EPPPEFPLASPYSGIVHHLSGPN 41 >ref|XP_001617522.1| hypothetical protein NEMVEDRAFT_v1g157418 [Nematostella vectensis] gi|156316853|ref|XP_001617998.1| hypothetical protein NEMVEDRAFT_v1g156102, partial [Nematostella vectensis] gi|156334645|ref|XP_001619497.1| hypothetical protein NEMVEDRAFT_v1g151180, partial [Nematostella vectensis] gi|156334789|ref|XP_001619525.1| hypothetical protein NEMVEDRAFT_v1g151074, partial [Nematostella vectensis] gi|156335454|ref|XP_001619588.1| hypothetical protein NEMVEDRAFT_v1g150899, partial [Nematostella vectensis] gi|156338629|ref|XP_001619991.1| hypothetical protein NEMVEDRAFT_v1g149572, partial [Nematostella vectensis] gi|156339212|ref|XP_001620113.1| hypothetical protein NEMVEDRAFT_v1g149125, partial [Nematostella vectensis] gi|156344469|ref|XP_001621197.1| hypothetical protein NEMVEDRAFT_v1g145709, partial [Nematostella vectensis] gi|156346062|ref|XP_001621427.1| hypothetical protein NEMVEDRAFT_v1g144945, partial [Nematostella vectensis] gi|156349461|ref|XP_001622068.1| hypothetical protein NEMVEDRAFT_v1g142631, partial [Nematostella vectensis] gi|156349556|ref|XP_001622108.1| predicted protein, partial [Nematostella vectensis] gi|156351363|ref|XP_001622477.1| predicted protein, partial [Nematostella vectensis] gi|156356944|ref|XP_001623986.1| predicted protein, partial [Nematostella vectensis] gi|156358537|ref|XP_001624574.1| predicted protein, partial [Nematostella vectensis] gi|156358779|ref|XP_001624692.1| predicted protein, partial [Nematostella vectensis] gi|156358783|ref|XP_001624694.1| predicted protein, partial [Nematostella vectensis] gi|156358787|ref|XP_001624696.1| predicted protein, partial [Nematostella vectensis] gi|156362285|ref|XP_001625710.1| predicted protein, partial [Nematostella vectensis] gi|156364331|ref|XP_001626302.1| predicted protein, partial [Nematostella vectensis] gi|156364335|ref|XP_001626304.1| predicted protein [Nematostella vectensis] gi|156400876|ref|XP_001639018.1| predicted protein, partial [Nematostella vectensis] gi|156603279|ref|XP_001618805.1| hypothetical protein NEMVEDRAFT_v1g153280, partial [Nematostella vectensis] gi|156603739|ref|XP_001618892.1| hypothetical protein NEMVEDRAFT_v1g153006, partial [Nematostella vectensis] gi|156194335|gb|EDO25422.1| predicted protein, partial [Nematostella vectensis] gi|156196887|gb|EDO25898.1| predicted protein, partial [Nematostella vectensis] gi|156200436|gb|EDO26705.1| predicted protein, partial [Nematostella vectensis] gi|156200809|gb|EDO26792.1| predicted protein, partial [Nematostella vectensis] gi|156202806|gb|EDO27397.1| predicted protein, partial [Nematostella vectensis] gi|156202922|gb|EDO27425.1| predicted protein, partial [Nematostella vectensis] gi|156203091|gb|EDO27488.1| predicted protein, partial [Nematostella vectensis] gi|156204181|gb|EDO27891.1| predicted protein, partial [Nematostella vectensis] gi|156204506|gb|EDO28013.1| predicted protein, partial [Nematostella vectensis] gi|156206904|gb|EDO29097.1| predicted protein, partial [Nematostella vectensis] gi|156207344|gb|EDO29327.1| predicted protein, partial [Nematostella vectensis] gi|156208479|gb|EDO29968.1| predicted protein, partial [Nematostella vectensis] gi|156208534|gb|EDO30008.1| predicted protein, partial [Nematostella vectensis] gi|156209028|gb|EDO30377.1| predicted protein, partial [Nematostella vectensis] gi|156210734|gb|EDO31886.1| predicted protein, partial [Nematostella vectensis] gi|156211363|gb|EDO32474.1| predicted protein, partial [Nematostella vectensis] gi|156211487|gb|EDO32592.1| predicted protein, partial [Nematostella vectensis] gi|156211489|gb|EDO32594.1| predicted protein, partial [Nematostella vectensis] gi|156211491|gb|EDO32596.1| predicted protein, partial [Nematostella vectensis] gi|156212555|gb|EDO33610.1| predicted protein, partial [Nematostella vectensis] gi|156213174|gb|EDO34202.1| predicted protein, partial [Nematostella vectensis] gi|156213176|gb|EDO34204.1| predicted protein, partial [Nematostella vectensis] gi|156226143|gb|EDO46955.1| predicted protein, partial [Nematostella vectensis] Length = 53 Score = 55.1 bits (131), Expect = 6e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +1 Query: 10 EPPPEFPLASPYSGIVHHLSGPN 78 EPPPEFPLASPYSGIVHHLSGPN Sbjct: 19 EPPPEFPLASPYSGIVHHLSGPN 41 >gb|KIK72365.1| hypothetical protein PAXRUDRAFT_47302, partial [Paxillus rubicundulus Ve08.2h10] Length = 55 Score = 55.1 bits (131), Expect = 6e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +1 Query: 10 EPPPEFPLASPYSGIVHHLSGPN 78 EPPPEFPLASPYSGIVHHLSGPN Sbjct: 19 EPPPEFPLASPYSGIVHHLSGPN 41 >gb|KIN97676.1| hypothetical protein M404DRAFT_159840, partial [Pisolithus tinctorius Marx 270] Length = 56 Score = 55.1 bits (131), Expect = 6e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +1 Query: 10 EPPPEFPLASPYSGIVHHLSGPN 78 EPPPEFPLASPYSGIVHHLSGPN Sbjct: 19 EPPPEFPLASPYSGIVHHLSGPN 41