BLASTX nr result
ID: Rehmannia28_contig00050316
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00050316 (422 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012830520.1| PREDICTED: protein LEO1 homolog [Erythranthe... 55 2e-06 >ref|XP_012830520.1| PREDICTED: protein LEO1 homolog [Erythranthe guttata] Length = 276 Score = 55.5 bits (132), Expect = 2e-06 Identities = 35/61 (57%), Positives = 40/61 (65%), Gaps = 11/61 (18%) Frame = -2 Query: 421 EEEPNYEDSDVEAE----GPKGKK------KLYIESDEDKPSRRTA-TRRQIANVYDGDD 275 EEE YEDS+VEAE PKGKK K YI+SDED P R +A TRR+ A +YD DD Sbjct: 216 EEEEFYEDSEVEAEMGSSKPKGKKSGRRLIKKYIDSDEDAPQRISATTRRKNAIIYDSDD 275 Query: 274 E 272 E Sbjct: 276 E 276