BLASTX nr result
ID: Rehmannia28_contig00050178
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00050178 (309 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU24861.1| hypothetical protein MIMGU_mgv1a006931mg [Erythra... 81 7e-16 ref|XP_012852418.1| PREDICTED: malonyl-coenzyme:anthocyanin 5-O-... 81 7e-16 gb|EYU42209.1| hypothetical protein MIMGU_mgv1a007129mg [Erythra... 79 3e-15 ref|XP_012852497.1| PREDICTED: malonyl-coenzyme:anthocyanin 5-O-... 79 3e-15 ref|XP_011093435.1| PREDICTED: malonyl-coenzyme:anthocyanin 5-O-... 79 3e-15 ref|XP_012852493.1| PREDICTED: malonyl-coenzyme:anthocyanin 5-O-... 79 3e-15 ref|XP_012852379.1| PREDICTED: malonyl-coenzyme:anthocyanin 5-O-... 79 3e-15 ref|XP_011100333.1| PREDICTED: malonyl-coenzyme:anthocyanin 5-O-... 79 5e-15 ref|XP_011093437.1| PREDICTED: malonyl-coenzyme:anthocyanin 5-O-... 77 1e-14 ref|XP_011093436.1| PREDICTED: malonyl-coenzyme:anthocyanin 5-O-... 77 1e-14 ref|XP_012852441.1| PREDICTED: malonyl-coenzyme:anthocyanin 5-O-... 77 2e-14 gb|EYU24856.1| hypothetical protein MIMGU_mgv1a017714mg [Erythra... 77 2e-14 ref|XP_011100429.1| PREDICTED: malonyl-coenzyme:anthocyanin 5-O-... 75 6e-14 ref|XP_012852486.1| PREDICTED: malonyl-coenzyme:anthocyanin 5-O-... 75 6e-14 gb|EYU24855.1| hypothetical protein MIMGU_mgv1a005957mg [Erythra... 74 1e-13 gb|AAR26386.1| putative acyltransferase [Salvia splendens] 74 3e-13 ref|XP_011100332.1| PREDICTED: malonyl-coenzyme:anthocyanin 5-O-... 71 2e-12 ref|XP_011079049.1| PREDICTED: anthocyanidin 3-O-glucoside 6''-O... 70 3e-12 gb|AAL50565.1|AF405204_1 malonyl CoA:anthocyanin 5-O-glucoside-6... 68 3e-11 sp|Q9MBC1.1|3AT_PERFR RecName: Full=Anthocyanidin 3-O-glucoside ... 67 6e-11 >gb|EYU24861.1| hypothetical protein MIMGU_mgv1a006931mg [Erythranthe guttata] Length = 426 Score = 80.9 bits (198), Expect = 7e-16 Identities = 40/45 (88%), Positives = 42/45 (93%) Frame = -2 Query: 308 VLSIDGEKYSMSLCKSADSEGGLEIGLSLPKERMEAFAAIFADGL 174 V+SIDGEKYS+SLCKS SEGGLEIGLSLPKERMEAFA IFADGL Sbjct: 382 VVSIDGEKYSISLCKSNGSEGGLEIGLSLPKERMEAFATIFADGL 426 >ref|XP_012852418.1| PREDICTED: malonyl-coenzyme:anthocyanin 5-O-glucoside-6'''-O-malonyltransferase-like [Erythranthe guttata] Length = 457 Score = 80.9 bits (198), Expect = 7e-16 Identities = 40/45 (88%), Positives = 42/45 (93%) Frame = -2 Query: 308 VLSIDGEKYSMSLCKSADSEGGLEIGLSLPKERMEAFAAIFADGL 174 V+SIDGEKYS+SLCKS SEGGLEIGLSLPKERMEAFA IFADGL Sbjct: 413 VVSIDGEKYSISLCKSNGSEGGLEIGLSLPKERMEAFATIFADGL 457 >gb|EYU42209.1| hypothetical protein MIMGU_mgv1a007129mg [Erythranthe guttata] Length = 418 Score = 79.0 bits (193), Expect = 3e-15 Identities = 37/46 (80%), Positives = 44/46 (95%) Frame = -2 Query: 308 VLSIDGEKYSMSLCKSADSEGGLEIGLSLPKERMEAFAAIFADGLR 171 V+SIDGE+ S+SLCKS DSEGGLEIGLS+PKERM+AFAA+FADGL+ Sbjct: 372 VVSIDGERCSISLCKSNDSEGGLEIGLSMPKERMDAFAAVFADGLK 417 >ref|XP_012852497.1| PREDICTED: malonyl-coenzyme:anthocyanin 5-O-glucoside-6'''-O-malonyltransferase-like [Erythranthe guttata] gi|604305765|gb|EYU24853.1| hypothetical protein MIMGU_mgv1a006246mg [Erythranthe guttata] Length = 451 Score = 79.0 bits (193), Expect = 3e-15 Identities = 37/46 (80%), Positives = 44/46 (95%) Frame = -2 Query: 308 VLSIDGEKYSMSLCKSADSEGGLEIGLSLPKERMEAFAAIFADGLR 171 V+SIDGE+ S+SLCKS DSEGGLEIGLS+PKERM+AFAA+FADGL+ Sbjct: 405 VVSIDGERCSISLCKSNDSEGGLEIGLSMPKERMDAFAAVFADGLK 450 >ref|XP_011093435.1| PREDICTED: malonyl-coenzyme:anthocyanin 5-O-glucoside-6'''-O-malonyltransferase-like [Sesamum indicum] Length = 453 Score = 79.0 bits (193), Expect = 3e-15 Identities = 37/46 (80%), Positives = 43/46 (93%) Frame = -2 Query: 308 VLSIDGEKYSMSLCKSADSEGGLEIGLSLPKERMEAFAAIFADGLR 171 V+SIDGEK+SMSLCKS DSEGGLE+G+SLPK RM+AFAAIF +GLR Sbjct: 407 VVSIDGEKHSMSLCKSRDSEGGLEVGISLPKARMDAFAAIFEEGLR 452 >ref|XP_012852493.1| PREDICTED: malonyl-coenzyme:anthocyanin 5-O-glucoside-6'''-O-malonyltransferase-like [Erythranthe guttata] gi|604305763|gb|EYU24851.1| hypothetical protein MIMGU_mgv1a006146mg [Erythranthe guttata] Length = 455 Score = 79.0 bits (193), Expect = 3e-15 Identities = 38/45 (84%), Positives = 43/45 (95%) Frame = -2 Query: 308 VLSIDGEKYSMSLCKSADSEGGLEIGLSLPKERMEAFAAIFADGL 174 V+SIDGEKYS+SLCKS SEGGLEIGL+LPK+RMEAFAAIFA+GL Sbjct: 411 VVSIDGEKYSISLCKSGGSEGGLEIGLALPKDRMEAFAAIFANGL 455 >ref|XP_012852379.1| PREDICTED: malonyl-coenzyme:anthocyanin 5-O-glucoside-6'''-O-malonyltransferase-like [Erythranthe guttata] gi|604305771|gb|EYU24859.1| hypothetical protein MIMGU_mgv1a023480mg [Erythranthe guttata] Length = 458 Score = 79.0 bits (193), Expect = 3e-15 Identities = 39/46 (84%), Positives = 43/46 (93%) Frame = -2 Query: 308 VLSIDGEKYSMSLCKSADSEGGLEIGLSLPKERMEAFAAIFADGLR 171 V+SIDGE+ S+SLCKS DSEGGLEIGLSLPKERM AFAAIFADGL+ Sbjct: 412 VVSIDGERCSISLCKSNDSEGGLEIGLSLPKERMTAFAAIFADGLK 457 >ref|XP_011100333.1| PREDICTED: malonyl-coenzyme:anthocyanin 5-O-glucoside-6'''-O-malonyltransferase-like [Sesamum indicum] Length = 451 Score = 78.6 bits (192), Expect = 5e-15 Identities = 37/46 (80%), Positives = 43/46 (93%) Frame = -2 Query: 308 VLSIDGEKYSMSLCKSADSEGGLEIGLSLPKERMEAFAAIFADGLR 171 V+SIDGEK+S+SLCKS DSEGGLE+G+SLP+ RMEAFAAIF DGLR Sbjct: 405 VVSIDGEKHSISLCKSRDSEGGLEVGMSLPRTRMEAFAAIFDDGLR 450 >ref|XP_011093437.1| PREDICTED: malonyl-coenzyme:anthocyanin 5-O-glucoside-6'''-O-malonyltransferase-like [Sesamum indicum] Length = 453 Score = 77.4 bits (189), Expect = 1e-14 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = -2 Query: 305 LSIDGEKYSMSLCKSADSEGGLEIGLSLPKERMEAFAAIFADGLR 171 +SIDGEK+SMSLCKS DSEGGLE+G+SLPK RM+AFAAIF +GLR Sbjct: 408 VSIDGEKHSMSLCKSRDSEGGLEVGISLPKARMDAFAAIFEEGLR 452 >ref|XP_011093436.1| PREDICTED: malonyl-coenzyme:anthocyanin 5-O-glucoside-6'''-O-malonyltransferase-like [Sesamum indicum] Length = 453 Score = 77.4 bits (189), Expect = 1e-14 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = -2 Query: 305 LSIDGEKYSMSLCKSADSEGGLEIGLSLPKERMEAFAAIFADGLR 171 +SIDGEK+SMSLCKS DSEGGLE+G+SLPK RM+AFAAIF +GLR Sbjct: 408 VSIDGEKHSMSLCKSRDSEGGLEVGISLPKARMDAFAAIFEEGLR 452 >ref|XP_012852441.1| PREDICTED: malonyl-coenzyme:anthocyanin 5-O-glucoside-6'''-O-malonyltransferase-like [Erythranthe guttata] Length = 458 Score = 76.6 bits (187), Expect = 2e-14 Identities = 38/46 (82%), Positives = 42/46 (91%) Frame = -2 Query: 308 VLSIDGEKYSMSLCKSADSEGGLEIGLSLPKERMEAFAAIFADGLR 171 V+SIDGE+ S+SLCKS DSEGGLEIG SLPKERM AFAAIFADGL+ Sbjct: 412 VVSIDGERCSISLCKSNDSEGGLEIGSSLPKERMTAFAAIFADGLK 457 >gb|EYU24856.1| hypothetical protein MIMGU_mgv1a017714mg [Erythranthe guttata] Length = 462 Score = 76.6 bits (187), Expect = 2e-14 Identities = 38/46 (82%), Positives = 42/46 (91%) Frame = -2 Query: 308 VLSIDGEKYSMSLCKSADSEGGLEIGLSLPKERMEAFAAIFADGLR 171 V+SIDGE+ S+SLCKS DSEGGLEIG SLPKERM AFAAIFADGL+ Sbjct: 416 VVSIDGERCSISLCKSNDSEGGLEIGSSLPKERMTAFAAIFADGLK 461 >ref|XP_011100429.1| PREDICTED: malonyl-coenzyme:anthocyanin 5-O-glucoside-6'''-O-malonyltransferase-like [Sesamum indicum] Length = 450 Score = 75.5 bits (184), Expect = 6e-14 Identities = 37/46 (80%), Positives = 40/46 (86%) Frame = -2 Query: 308 VLSIDGEKYSMSLCKSADSEGGLEIGLSLPKERMEAFAAIFADGLR 171 VL+ID EKYSMSLCKS DS+GGLEIG+SLP RMEAFA IF DGLR Sbjct: 404 VLTIDEEKYSMSLCKSRDSDGGLEIGMSLPMARMEAFATIFNDGLR 449 >ref|XP_012852486.1| PREDICTED: malonyl-coenzyme:anthocyanin 5-O-glucoside-6'''-O-malonyltransferase-like [Erythranthe guttata] gi|604305764|gb|EYU24852.1| hypothetical protein MIMGU_mgv1a006230mg [Erythranthe guttata] Length = 452 Score = 75.5 bits (184), Expect = 6e-14 Identities = 36/46 (78%), Positives = 43/46 (93%) Frame = -2 Query: 308 VLSIDGEKYSMSLCKSADSEGGLEIGLSLPKERMEAFAAIFADGLR 171 V+SIDGE+ S+SLCKS DSEGGLEIGLS+PKERM+AFAA FA+GL+ Sbjct: 406 VVSIDGERCSISLCKSNDSEGGLEIGLSMPKERMDAFAAAFANGLK 451 >gb|EYU24855.1| hypothetical protein MIMGU_mgv1a005957mg [Erythranthe guttata] Length = 463 Score = 74.3 bits (181), Expect = 1e-13 Identities = 34/46 (73%), Positives = 42/46 (91%) Frame = -2 Query: 308 VLSIDGEKYSMSLCKSADSEGGLEIGLSLPKERMEAFAAIFADGLR 171 V+SIDG++ S+SLCKS DSEGGLEIGLSLPKE+M+ FAA+F DGL+ Sbjct: 417 VVSIDGQRCSISLCKSNDSEGGLEIGLSLPKEKMDVFAAVFGDGLK 462 >gb|AAR26386.1| putative acyltransferase [Salvia splendens] Length = 459 Score = 73.6 bits (179), Expect = 3e-13 Identities = 35/46 (76%), Positives = 40/46 (86%) Frame = -2 Query: 308 VLSIDGEKYSMSLCKSADSEGGLEIGLSLPKERMEAFAAIFADGLR 171 VLS+D EKYSMSLC S+DS GGL +GLSLPKERM+AFA IF DGL+ Sbjct: 413 VLSMDKEKYSMSLCNSSDSPGGLVVGLSLPKERMDAFATIFEDGLK 458 >ref|XP_011100332.1| PREDICTED: malonyl-coenzyme:anthocyanin 5-O-glucoside-6'''-O-malonyltransferase-like [Sesamum indicum] Length = 450 Score = 70.9 bits (172), Expect = 2e-12 Identities = 35/46 (76%), Positives = 38/46 (82%) Frame = -2 Query: 308 VLSIDGEKYSMSLCKSADSEGGLEIGLSLPKERMEAFAAIFADGLR 171 VL ID +KYSMSLCKS DS+G LEIG+SLPK RME FA IF DGLR Sbjct: 404 VLMIDEQKYSMSLCKSRDSDGVLEIGMSLPKARMETFATIFNDGLR 449 >ref|XP_011079049.1| PREDICTED: anthocyanidin 3-O-glucoside 6''-O-acyltransferase-like [Sesamum indicum] Length = 483 Score = 70.5 bits (171), Expect = 3e-12 Identities = 34/45 (75%), Positives = 38/45 (84%) Frame = -2 Query: 305 LSIDGEKYSMSLCKSADSEGGLEIGLSLPKERMEAFAAIFADGLR 171 LSIDGE YSMSLCK+ SEGGLE+GLSLPK M AFAA FADG++ Sbjct: 437 LSIDGENYSMSLCKAGASEGGLEVGLSLPKVIMAAFAAAFADGIK 481 >gb|AAL50565.1|AF405204_1 malonyl CoA:anthocyanin 5-O-glucoside-6'''-O-malonyltransferase [Perilla frutescens] Length = 447 Score = 67.8 bits (164), Expect = 3e-11 Identities = 35/45 (77%), Positives = 40/45 (88%) Frame = -2 Query: 308 VLSIDGEKYSMSLCKSADSEGGLEIGLSLPKERMEAFAAIFADGL 174 V+SIDGEKY+MSLC +S+ GLE+GLSLP ERMEAFAAIFADGL Sbjct: 400 VVSIDGEKYTMSLC---NSDCGLEVGLSLPGERMEAFAAIFADGL 441 >sp|Q9MBC1.1|3AT_PERFR RecName: Full=Anthocyanidin 3-O-glucoside 6''-O-acyltransferase; Short=3AT, partial [Perilla frutescens] gi|7415646|dbj|BAA93475.1| anthocyanin acyltransferase [Perilla frutescens] Length = 446 Score = 67.0 bits (162), Expect = 6e-11 Identities = 30/45 (66%), Positives = 40/45 (88%) Frame = -2 Query: 308 VLSIDGEKYSMSLCKSADSEGGLEIGLSLPKERMEAFAAIFADGL 174 +LSIDGEKY+M+LCK+ D EGGLE+ LSLPK++M+AFAA F+ G+ Sbjct: 400 ILSIDGEKYAMTLCKARDFEGGLEVCLSLPKDKMDAFAAYFSLGI 444