BLASTX nr result
ID: Rehmannia28_contig00049496
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00049496 (515 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011094645.1| PREDICTED: auxin-induced protein 15A [Sesamu... 62 1e-09 ref|XP_002281876.2| PREDICTED: indole-3-acetic acid-induced prot... 62 3e-09 ref|XP_015087322.1| PREDICTED: indole-3-acetic acid-induced prot... 61 5e-09 emb|CBI32752.3| unnamed protein product [Vitis vinifera] 59 4e-08 >ref|XP_011094645.1| PREDICTED: auxin-induced protein 15A [Sesamum indicum] Length = 126 Score = 62.4 bits (150), Expect = 1e-09 Identities = 30/42 (71%), Positives = 30/42 (71%), Gaps = 1/42 (2%) Frame = +1 Query: 388 MNITNGKFLKACKKKWRIMGRRVEPSVAACD-ACCKWPLWPS 510 MNI NGK LK C KKWR MGRRV P AACD CC W LWPS Sbjct: 1 MNIMNGKLLKTCMKKWRRMGRRVIP-CAACDMCCCGWSLWPS 41 >ref|XP_002281876.2| PREDICTED: indole-3-acetic acid-induced protein ARG7 [Vitis vinifera] Length = 127 Score = 61.6 bits (148), Expect = 3e-09 Identities = 27/41 (65%), Positives = 30/41 (73%) Frame = +1 Query: 388 MNITNGKFLKACKKKWRIMGRRVEPSVAACDACCKWPLWPS 510 M I GKFL+AC +KWR MG RV PS A CD CC+W LWPS Sbjct: 1 MKIMRGKFLRACLEKWRRMGSRVIPS-AGCDYCCQWALWPS 40 >ref|XP_015087322.1| PREDICTED: indole-3-acetic acid-induced protein ARG7 [Solanum pennellii] Length = 127 Score = 60.8 bits (146), Expect = 5e-09 Identities = 23/40 (57%), Positives = 29/40 (72%) Frame = +1 Query: 388 MNITNGKFLKACKKKWRIMGRRVEPSVAACDACCKWPLWP 507 M + + KFLKAC+ KW+ MG +V PS A CD CCKW +WP Sbjct: 1 MKMMDSKFLKACQNKWQKMGGKVIPSSACCDKCCKWSMWP 40 >emb|CBI32752.3| unnamed protein product [Vitis vinifera] Length = 124 Score = 58.5 bits (140), Expect = 4e-08 Identities = 25/36 (69%), Positives = 28/36 (77%) Frame = +1 Query: 403 GKFLKACKKKWRIMGRRVEPSVAACDACCKWPLWPS 510 GKFL+AC +KWR MG RV PS A CD CC+W LWPS Sbjct: 3 GKFLRACLEKWRRMGSRVIPS-AGCDYCCQWALWPS 37