BLASTX nr result
ID: Rehmannia28_contig00049401
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00049401 (424 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011079978.1| PREDICTED: non-specific lipid-transfer prote... 54 3e-06 >ref|XP_011079978.1| PREDICTED: non-specific lipid-transfer protein 3 [Sesamum indicum] Length = 209 Score = 54.3 bits (129), Expect = 3e-06 Identities = 28/53 (52%), Positives = 33/53 (62%) Frame = -3 Query: 269 ESLDVTPAAPPPKFSLGPSANPGVRPVVNPNSAXXXXXXXXXXXXXIMHIGIM 111 E D+ PA PP FSLGPSANPG+RPVVNPNSA ++ +GIM Sbjct: 153 EISDIEPATPPD-FSLGPSANPGIRPVVNPNSASNPSTSTLLPYLVLIFVGIM 204