BLASTX nr result
ID: Rehmannia28_contig00048992
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00048992 (454 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010097040.1| hypothetical protein L484_003871 [Morus nota... 56 5e-08 >ref|XP_010097040.1| hypothetical protein L484_003871 [Morus notabilis] gi|587877751|gb|EXB66778.1| hypothetical protein L484_003871 [Morus notabilis] Length = 72 Score = 56.2 bits (134), Expect = 5e-08 Identities = 27/35 (77%), Positives = 30/35 (85%), Gaps = 1/35 (2%) Frame = +1 Query: 352 ISLVGFCD-IAGKQLMVHVAELVPRHPGRTKKQEP 453 IS + CD IAGKQLM+ +AELVPRHPGRTKKQEP Sbjct: 19 ISSISCCDCIAGKQLMLRIAELVPRHPGRTKKQEP 53