BLASTX nr result
ID: Rehmannia28_contig00047338
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00047338 (377 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU36190.1| hypothetical protein MIMGU_mgv1a014702mg [Erythra... 99 1e-23 ref|XP_012838181.1| PREDICTED: putative B3 domain-containing pro... 99 5e-22 ref|XP_010315502.1| PREDICTED: putative B3 domain-containing pro... 65 6e-10 ref|XP_009769341.1| PREDICTED: B3 domain-containing protein REM2... 63 2e-09 ref|XP_015089734.1| PREDICTED: B3 domain-containing protein At5g... 63 2e-09 ref|XP_009769340.1| PREDICTED: B3 domain-containing protein At4g... 63 3e-09 ref|XP_009613232.1| PREDICTED: B3 domain-containing protein At5g... 62 6e-09 ref|XP_004231373.1| PREDICTED: B3 domain-containing protein At5g... 62 6e-09 ref|XP_009613231.1| PREDICTED: B3 domain-containing protein At5g... 62 7e-09 emb|CDP12499.1| unnamed protein product [Coffea canephora] 61 2e-08 ref|XP_010315503.1| PREDICTED: B3 domain-containing protein At5g... 58 4e-08 ref|XP_015071035.1| PREDICTED: B3 domain-containing protein At5g... 59 5e-08 ref|XP_006351837.1| PREDICTED: B3 domain-containing protein At5g... 58 1e-07 ref|XP_015159608.1| PREDICTED: B3 domain-containing protein At3g... 57 2e-07 ref|XP_012834169.1| PREDICTED: B3 domain-containing protein At5g... 57 4e-07 ref|XP_015163791.1| PREDICTED: glutamic acid-rich protein-like [... 56 7e-07 ref|XP_011084088.1| PREDICTED: putative B3 domain-containing pro... 55 1e-06 ref|XP_015065560.1| PREDICTED: B3 domain-containing protein At5g... 55 2e-06 emb|CDP12500.1| unnamed protein product [Coffea canephora] 55 2e-06 ref|XP_004231660.1| PREDICTED: B3 domain-containing protein At5g... 55 2e-06 >gb|EYU36190.1| hypothetical protein MIMGU_mgv1a014702mg [Erythranthe guttata] Length = 181 Score = 98.6 bits (244), Expect = 1e-23 Identities = 50/76 (65%), Positives = 58/76 (76%) Frame = +2 Query: 146 NTSKNRGSTYGVETIPSKRSYKKKNVLEDCYGADIFRSGLAPRPNNPYFVTRSRTKARKN 325 +T+ RG+T G IP +R +KKK+ L DCYGADIFRSGLA P NPYFV+RSR RKN Sbjct: 34 STNSTRGNTSGNGNIPCERIFKKKD-LPDCYGADIFRSGLASVPKNPYFVSRSRVARRKN 92 Query: 326 ELHIPKDVIVDYHLNI 373 EL+IPKDVIVDY L I Sbjct: 93 ELYIPKDVIVDYGLKI 108 >ref|XP_012838181.1| PREDICTED: putative B3 domain-containing protein At5g66980 [Erythranthe guttata] Length = 405 Score = 98.6 bits (244), Expect = 5e-22 Identities = 50/76 (65%), Positives = 58/76 (76%) Frame = +2 Query: 146 NTSKNRGSTYGVETIPSKRSYKKKNVLEDCYGADIFRSGLAPRPNNPYFVTRSRTKARKN 325 +T+ RG+T G IP +R +KKK+ L DCYGADIFRSGLA P NPYFV+RSR RKN Sbjct: 258 STNSTRGNTSGNGNIPCERIFKKKD-LPDCYGADIFRSGLASVPKNPYFVSRSRVARRKN 316 Query: 326 ELHIPKDVIVDYHLNI 373 EL+IPKDVIVDY L I Sbjct: 317 ELYIPKDVIVDYGLKI 332 >ref|XP_010315502.1| PREDICTED: putative B3 domain-containing protein Os03g0621600 [Solanum lycopersicum] Length = 705 Score = 65.1 bits (157), Expect = 6e-10 Identities = 37/80 (46%), Positives = 48/80 (60%), Gaps = 6/80 (7%) Frame = +2 Query: 155 KNRGSTYGVETIPSKRSYKK------KNVLEDCYGADIFRSGLAPRPNNPYFVTRSRTKA 316 + T G +T SK +K +NV D YGADIFRSG A +P NPYFV + R K Sbjct: 551 RKENETDGEDTSASKAGRRKAITCKVRNV-HDKYGADIFRSGRATQPKNPYFVAKMRAKM 609 Query: 317 RKNELHIPKDVIVDYHLNIP 376 R N+L++P DV+ DY L +P Sbjct: 610 R-NQLYVPIDVVRDYKLELP 628 Score = 54.7 bits (130), Expect = 3e-06 Identities = 27/56 (48%), Positives = 39/56 (69%) Frame = +2 Query: 209 KKKNVLEDCYGADIFRSGLAPRPNNPYFVTRSRTKARKNELHIPKDVIVDYHLNIP 376 K +N++ D +G DIFRSG A +P NPYFV + K R+N+ ++P DV+ DY L +P Sbjct: 211 KVRNMI-DRHGIDIFRSGSATKPKNPYFVAKIIAK-RRNQQYVPIDVVRDYKLELP 264 >ref|XP_009769341.1| PREDICTED: B3 domain-containing protein REM20-like isoform X2 [Nicotiana sylvestris] Length = 330 Score = 63.2 bits (152), Expect = 2e-09 Identities = 29/55 (52%), Positives = 41/55 (74%) Frame = +2 Query: 212 KKNVLEDCYGADIFRSGLAPRPNNPYFVTRSRTKARKNELHIPKDVIVDYHLNIP 376 KK + D YGA+IFRSG A +P NPYFV + R K R+++L++P DV+ DY+L +P Sbjct: 201 KKRDVPDQYGAEIFRSGRATQPKNPYFVAKIRAK-RRDQLYVPVDVVRDYNLELP 254 >ref|XP_015089734.1| PREDICTED: B3 domain-containing protein At5g60140-like [Solanum pennellii] Length = 347 Score = 63.2 bits (152), Expect = 2e-09 Identities = 34/79 (43%), Positives = 45/79 (56%), Gaps = 5/79 (6%) Frame = +2 Query: 155 KNRGSTYGVETIPSKRSYKKK-----NVLEDCYGADIFRSGLAPRPNNPYFVTRSRTKAR 319 + T G +T SK +K + D YGADIF SG A +P NPYFV + R K R Sbjct: 193 RKENETDGEDTSASKAGRRKAITCKVRTVHDKYGADIFTSGRATQPKNPYFVAKMRAKMR 252 Query: 320 KNELHIPKDVIVDYHLNIP 376 N+L++P DV+ DY L +P Sbjct: 253 -NQLYVPIDVVRDYKLELP 270 >ref|XP_009769340.1| PREDICTED: B3 domain-containing protein At4g34400-like isoform X1 [Nicotiana sylvestris] Length = 375 Score = 63.2 bits (152), Expect = 3e-09 Identities = 29/55 (52%), Positives = 41/55 (74%) Frame = +2 Query: 212 KKNVLEDCYGADIFRSGLAPRPNNPYFVTRSRTKARKNELHIPKDVIVDYHLNIP 376 KK + D YGA+IFRSG A +P NPYFV + R K R+++L++P DV+ DY+L +P Sbjct: 246 KKRDVPDQYGAEIFRSGRATQPKNPYFVAKIRAK-RRDQLYVPVDVVRDYNLELP 299 >ref|XP_009613232.1| PREDICTED: B3 domain-containing protein At5g60140-like isoform X2 [Nicotiana tomentosiformis] Length = 328 Score = 62.0 bits (149), Expect = 6e-09 Identities = 28/55 (50%), Positives = 41/55 (74%) Frame = +2 Query: 212 KKNVLEDCYGADIFRSGLAPRPNNPYFVTRSRTKARKNELHIPKDVIVDYHLNIP 376 K+ + D YGA+IFRSG A +P NPYFV + R K R+++L++P DV+ DY+L +P Sbjct: 199 KRRDVPDQYGAEIFRSGRATQPKNPYFVAKIRAK-RRDQLYVPVDVVRDYNLELP 252 >ref|XP_004231373.1| PREDICTED: B3 domain-containing protein At5g60140-like [Solanum lycopersicum] gi|723664743|ref|XP_004230633.2| PREDICTED: B3 domain-containing protein At5g60140-like [Solanum lycopersicum] Length = 336 Score = 62.0 bits (149), Expect = 6e-09 Identities = 31/72 (43%), Positives = 46/72 (63%) Frame = +2 Query: 161 RGSTYGVETIPSKRSYKKKNVLEDCYGADIFRSGLAPRPNNPYFVTRSRTKARKNELHIP 340 R +T+ E + SK K D +G DIF+SG A +P NPYFV + R+K R+++L++P Sbjct: 191 RTNTHKKEALRSKAFACKVRNRHDHFGVDIFKSGRATQPKNPYFVAKIRSK-RRDQLYVP 249 Query: 341 KDVIVDYHLNIP 376 DV+ DY L +P Sbjct: 250 VDVVKDYKLELP 261 >ref|XP_009613231.1| PREDICTED: B3 domain-containing protein At5g60140-like isoform X1 [Nicotiana tomentosiformis] Length = 375 Score = 62.0 bits (149), Expect = 7e-09 Identities = 28/55 (50%), Positives = 41/55 (74%) Frame = +2 Query: 212 KKNVLEDCYGADIFRSGLAPRPNNPYFVTRSRTKARKNELHIPKDVIVDYHLNIP 376 K+ + D YGA+IFRSG A +P NPYFV + R K R+++L++P DV+ DY+L +P Sbjct: 246 KRRDVPDQYGAEIFRSGRATQPKNPYFVAKIRAK-RRDQLYVPVDVVRDYNLELP 299 >emb|CDP12499.1| unnamed protein product [Coffea canephora] Length = 337 Score = 60.8 bits (146), Expect = 2e-08 Identities = 28/57 (49%), Positives = 42/57 (73%) Frame = +2 Query: 206 YKKKNVLEDCYGADIFRSGLAPRPNNPYFVTRSRTKARKNELHIPKDVIVDYHLNIP 376 +K K + D YG ++F+SG P+P NPYFVT+ RTK R++EL++P DV+ D++L P Sbjct: 213 WKAKRI--DAYGFNLFKSGKIPQPKNPYFVTKVRTK-RQDELYVPVDVVKDHNLEFP 266 >ref|XP_010315503.1| PREDICTED: B3 domain-containing protein At5g60140-like [Solanum lycopersicum] Length = 149 Score = 57.8 bits (138), Expect = 4e-08 Identities = 27/51 (52%), Positives = 37/51 (72%) Frame = +2 Query: 224 LEDCYGADIFRSGLAPRPNNPYFVTRSRTKARKNELHIPKDVIVDYHLNIP 376 + D YGADIF+SG A +P NPYFV + R K R+++L+I DV+ DY L +P Sbjct: 36 IPDQYGADIFKSGCATQPKNPYFVAKIRAK-RRDQLYISIDVVRDYKLELP 85 >ref|XP_015071035.1| PREDICTED: B3 domain-containing protein At5g60130-like [Solanum pennellii] gi|969998094|ref|XP_015071045.1| PREDICTED: B3 domain-containing protein At5g60130-like [Solanum pennellii] Length = 324 Score = 59.3 bits (142), Expect = 5e-08 Identities = 29/65 (44%), Positives = 42/65 (64%) Frame = +2 Query: 182 ETIPSKRSYKKKNVLEDCYGADIFRSGLAPRPNNPYFVTRSRTKARKNELHIPKDVIVDY 361 E + SK K D +G DIF+SG A +P NPYFV + R+K R+++L++P DV+ DY Sbjct: 187 EALRSKAFACKVRNRHDHFGVDIFKSGRATQPKNPYFVAKIRSK-RRDQLYVPVDVVKDY 245 Query: 362 HLNIP 376 L +P Sbjct: 246 KLELP 250 >ref|XP_006351837.1| PREDICTED: B3 domain-containing protein At5g60140-like [Solanum tuberosum] Length = 350 Score = 58.2 bits (139), Expect = 1e-07 Identities = 30/76 (39%), Positives = 44/76 (57%), Gaps = 5/76 (6%) Frame = +2 Query: 164 GSTYGVETIPSKRSYKKKNVLE-----DCYGADIFRSGLAPRPNNPYFVTRSRTKARKNE 328 G T+ K S K + D +G DIF+SG A +P NPYFV + R+K R+++ Sbjct: 201 GENQRANTLKKKESRSKAFACKVRNRHDHFGVDIFKSGRATQPKNPYFVAKIRSK-RRDQ 259 Query: 329 LHIPKDVIVDYHLNIP 376 L++P DV+ DY L +P Sbjct: 260 LYVPVDVVKDYKLELP 275 >ref|XP_015159608.1| PREDICTED: B3 domain-containing protein At3g06220-like [Solanum tuberosum] Length = 297 Score = 57.4 bits (137), Expect = 2e-07 Identities = 27/55 (49%), Positives = 36/55 (65%) Frame = +2 Query: 212 KKNVLEDCYGADIFRSGLAPRPNNPYFVTRSRTKARKNELHIPKDVIVDYHLNIP 376 K N D + DIFRSG A +P NPYFVT+ R R+N L++P D++ DY L +P Sbjct: 171 KVNNPHDQFATDIFRSGRATKPKNPYFVTKIRPD-RRNHLYVPADMVRDYQLELP 224 >ref|XP_012834169.1| PREDICTED: B3 domain-containing protein At5g57720-like [Erythranthe guttata] Length = 490 Score = 57.0 bits (136), Expect = 4e-07 Identities = 29/64 (45%), Positives = 41/64 (64%) Frame = +2 Query: 185 TIPSKRSYKKKNVLEDCYGADIFRSGLAPRPNNPYFVTRSRTKARKNELHIPKDVIVDYH 364 T K+ + + D YG +IF++GL P NPYFVT+ TK RK EL+IPK+V+ D Sbjct: 356 TTGEKKKRTRTRRVTDIYGREIFKAGLMAVPVNPYFVTKINTK-RKGELYIPKEVVRDNI 414 Query: 365 LNIP 376 L++P Sbjct: 415 LDLP 418 >ref|XP_015163791.1| PREDICTED: glutamic acid-rich protein-like [Solanum tuberosum] Length = 376 Score = 56.2 bits (134), Expect = 7e-07 Identities = 27/49 (55%), Positives = 36/49 (73%) Frame = +2 Query: 230 DCYGADIFRSGLAPRPNNPYFVTRSRTKARKNELHIPKDVIVDYHLNIP 376 D YGADIF+SG A +P N YFV + R K R+++L+IP DV+ DY L +P Sbjct: 256 DQYGADIFKSGRATQPKNLYFVAKIRVK-RRDQLYIPIDVVRDYKLELP 303 Score = 53.1 bits (126), Expect = 8e-06 Identities = 23/49 (46%), Positives = 36/49 (73%) Frame = +2 Query: 230 DCYGADIFRSGLAPRPNNPYFVTRSRTKARKNELHIPKDVIVDYHLNIP 376 D +GADIF+SG A RP NPYF+ + + K R+++L++P DVI ++ +P Sbjct: 68 DQFGADIFKSGHATRPRNPYFIAKLQAK-RRDQLYVPIDVIKGFNFELP 115 >ref|XP_011084088.1| PREDICTED: putative B3 domain-containing protein At5g66980 [Sesamum indicum] Length = 323 Score = 55.5 bits (132), Expect = 1e-06 Identities = 29/68 (42%), Positives = 44/68 (64%) Frame = +2 Query: 173 YGVETIPSKRSYKKKNVLEDCYGADIFRSGLAPRPNNPYFVTRSRTKARKNELHIPKDVI 352 +G + S++ + + V D YGA+IFR+GLA P +PYF+T+ RK EL+IP D+I Sbjct: 189 HGTSSNTSEKQSRCRRV-PDIYGAEIFRTGLATYPKHPYFITKI-NPGRKGELYIPMDLI 246 Query: 353 VDYHLNIP 376 +LN+P Sbjct: 247 KVQNLNLP 254 >ref|XP_015065560.1| PREDICTED: B3 domain-containing protein At5g60140-like [Solanum pennellii] Length = 345 Score = 55.1 bits (131), Expect = 2e-06 Identities = 31/77 (40%), Positives = 46/77 (59%), Gaps = 5/77 (6%) Frame = +2 Query: 161 RGSTYGVETIPSKRSYKKKNV-----LEDCYGADIFRSGLAPRPNNPYFVTRSRTKARKN 325 R TY + SK +K NV + + YGADIF+SG +P NPYFV + + + R + Sbjct: 193 RVGTYTEKVQHSKVGCRKVNVCKVSDIPEHYGADIFKSGRVTQPKNPYFVAKIQERIR-D 251 Query: 326 ELHIPKDVIVDYHLNIP 376 +L+IP +V+ DY L +P Sbjct: 252 KLYIPMEVLRDYKLELP 268 >emb|CDP12500.1| unnamed protein product [Coffea canephora] Length = 451 Score = 55.1 bits (131), Expect = 2e-06 Identities = 23/56 (41%), Positives = 40/56 (71%) Frame = +2 Query: 209 KKKNVLEDCYGADIFRSGLAPRPNNPYFVTRSRTKARKNELHIPKDVIVDYHLNIP 376 +++ L D YG D+F+SG +P NPYFVT+ R + R++ L++P D++ D++L +P Sbjct: 327 RRRRWLIDPYGYDLFKSGCISQPKNPYFVTQKRAR-RQDALYVPHDILRDHNLKLP 381 >ref|XP_004231660.1| PREDICTED: B3 domain-containing protein At5g60140-like [Solanum lycopersicum] Length = 345 Score = 54.7 bits (130), Expect = 2e-06 Identities = 31/74 (41%), Positives = 45/74 (60%), Gaps = 5/74 (6%) Frame = +2 Query: 170 TYGVETIPSKRSYKKKNV-----LEDCYGADIFRSGLAPRPNNPYFVTRSRTKARKNELH 334 TY + SK +K NV + + YGADIF+SG +P NPYFV + + + R ++L+ Sbjct: 196 TYTEKVQHSKVGCQKVNVCRVRDIPEHYGADIFKSGRVTQPKNPYFVAKIQERIR-DKLY 254 Query: 335 IPKDVIVDYHLNIP 376 IP +VI DY L +P Sbjct: 255 IPMEVIRDYKLELP 268