BLASTX nr result
ID: Rehmannia28_contig00047283
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00047283 (320 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011098777.1| PREDICTED: ethylene-responsive transcription... 69 2e-11 >ref|XP_011098777.1| PREDICTED: ethylene-responsive transcription factor 10-like [Sesamum indicum] Length = 379 Score = 68.6 bits (166), Expect = 2e-11 Identities = 34/72 (47%), Positives = 49/72 (68%) Frame = +3 Query: 21 SVDQKQGIEKYTDEIPDFSENNITDFLNDPDEDYSVENNSLINTSDYNXXXXXXAITQTH 200 S+ Q++ +E YTDE+PDFSE DF+NDPDE++S+ENNSLI SDY ++ + Sbjct: 157 SIAQEREME-YTDEVPDFSEPYFGDFINDPDENFSMENNSLIAASDYKSLSFESSVIEAD 215 Query: 201 CSHQTSEQQNNS 236 + QTSE + +S Sbjct: 216 SNCQTSEHKVSS 227