BLASTX nr result
ID: Rehmannia28_contig00047146
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00047146 (368 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011096814.1| PREDICTED: stromal 70 kDa heat shock-related... 69 3e-11 ref|XP_012854974.1| PREDICTED: heat shock 70 kDa protein 6, chlo... 61 1e-08 >ref|XP_011096814.1| PREDICTED: stromal 70 kDa heat shock-related protein, chloroplastic-like [Sesamum indicum] Length = 694 Score = 68.9 bits (167), Expect = 3e-11 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = +2 Query: 272 MATAAQLHCPFPQTGNKTPFLGLKTIKTTPFI 367 MATAAQLHCPFPQTGNKTPFLGLKTIK TPFI Sbjct: 1 MATAAQLHCPFPQTGNKTPFLGLKTIKKTPFI 32 >ref|XP_012854974.1| PREDICTED: heat shock 70 kDa protein 6, chloroplastic-like [Erythranthe guttata] gi|604303356|gb|EYU22829.1| hypothetical protein MIMGU_mgv1a002344mg [Erythranthe guttata] Length = 686 Score = 61.2 bits (147), Expect = 1e-08 Identities = 27/32 (84%), Positives = 28/32 (87%) Frame = +2 Query: 272 MATAAQLHCPFPQTGNKTPFLGLKTIKTTPFI 367 MAT AQ+HCPFPQTGNKTPF G KTIK TPFI Sbjct: 1 MATTAQIHCPFPQTGNKTPFPGPKTIKKTPFI 32