BLASTX nr result
ID: Rehmannia28_contig00046982
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00046982 (374 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS66266.1| hypothetical protein M569_08512, partial [Genlise... 59 1e-08 emb|CAK18868.1| type II homeodomain-leucine zipper protein precu... 57 3e-08 gb|KJB36148.1| hypothetical protein B456_006G143600 [Gossypium r... 59 5e-08 ref|XP_004493598.1| PREDICTED: homeobox-leucine zipper protein H... 59 9e-08 ref|XP_012485645.1| PREDICTED: homeobox-leucine zipper protein H... 59 9e-08 ref|XP_011075258.1| PREDICTED: homeobox-leucine zipper protein H... 59 1e-07 ref|XP_015969427.1| PREDICTED: homeobox-leucine zipper protein H... 57 1e-07 gb|KHN41711.1| Homeobox-leucine zipper protein HAT14 [Glycine soja] 57 1e-07 ref|XP_006388580.1| hypothetical protein POPTR_0149s00220g [Popu... 57 2e-07 ref|XP_009604991.1| PREDICTED: homeobox-leucine zipper protein H... 57 2e-07 emb|CDX81016.1| BnaC03g02700D [Brassica napus] 57 2e-07 ref|XP_009604990.1| PREDICTED: homeobox-leucine zipper protein H... 57 2e-07 ref|XP_010557949.1| PREDICTED: homeobox-leucine zipper protein H... 57 2e-07 ref|XP_009604989.1| PREDICTED: homeobox-leucine zipper protein H... 57 2e-07 ref|XP_009604988.1| PREDICTED: homeobox-leucine zipper protein H... 57 2e-07 ref|XP_009130954.1| PREDICTED: homeobox-leucine zipper protein H... 57 2e-07 ref|XP_013723745.1| PREDICTED: homeobox-leucine zipper protein H... 57 2e-07 ref|XP_008351552.1| PREDICTED: homeobox-leucine zipper protein H... 57 2e-07 emb|CBI30005.3| unnamed protein product [Vitis vinifera] 57 2e-07 ref|XP_003533912.1| PREDICTED: homeobox-leucine zipper protein H... 57 2e-07 >gb|EPS66266.1| hypothetical protein M569_08512, partial [Genlisea aurea] Length = 132 Score = 58.5 bits (140), Expect = 1e-08 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -2 Query: 373 VQELRALKASKPFYMQHPATTLTMCPSCEK 284 +QELRALKAS+PFYMQ PATTLTMCPSCE+ Sbjct: 99 LQELRALKASQPFYMQLPATTLTMCPSCER 128 >emb|CAK18868.1| type II homeodomain-leucine zipper protein precursor [Phillyrea latifolia] Length = 106 Score = 57.0 bits (136), Expect = 3e-08 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -2 Query: 373 VQELRALKASKPFYMQHPATTLTMCPSCEK 284 +QELRALK S+PFYMQ PATTLTMCPSCE+ Sbjct: 49 LQELRALKTSQPFYMQLPATTLTMCPSCER 78 >gb|KJB36148.1| hypothetical protein B456_006G143600 [Gossypium raimondii] Length = 215 Score = 58.5 bits (140), Expect = 5e-08 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -2 Query: 373 VQELRALKASKPFYMQHPATTLTMCPSCEK 284 +QELRALKAS+PFYMQ PATTLTMCPSCE+ Sbjct: 164 LQELRALKASQPFYMQLPATTLTMCPSCER 193 >ref|XP_004493598.1| PREDICTED: homeobox-leucine zipper protein HOX11 [Cicer arietinum] Length = 290 Score = 58.5 bits (140), Expect = 9e-08 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -2 Query: 373 VQELRALKASKPFYMQHPATTLTMCPSCEK 284 +QELRALK SKPFYMQ PATTLTMCPSCE+ Sbjct: 221 LQELRALKTSKPFYMQLPATTLTMCPSCER 250 >ref|XP_012485645.1| PREDICTED: homeobox-leucine zipper protein HAT14-like [Gossypium raimondii] gi|763768932|gb|KJB36147.1| hypothetical protein B456_006G143600 [Gossypium raimondii] Length = 306 Score = 58.5 bits (140), Expect = 9e-08 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -2 Query: 373 VQELRALKASKPFYMQHPATTLTMCPSCEK 284 +QELRALKAS+PFYMQ PATTLTMCPSCE+ Sbjct: 255 LQELRALKASQPFYMQLPATTLTMCPSCER 284 >ref|XP_011075258.1| PREDICTED: homeobox-leucine zipper protein HOX11 [Sesamum indicum] Length = 325 Score = 58.5 bits (140), Expect = 1e-07 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -2 Query: 373 VQELRALKASKPFYMQHPATTLTMCPSCEK 284 +QELRALKAS+PFYMQ PATTLTMCPSCE+ Sbjct: 262 LQELRALKASQPFYMQLPATTLTMCPSCER 291 >ref|XP_015969427.1| PREDICTED: homeobox-leucine zipper protein HOX11 [Arachis duranensis] Length = 185 Score = 57.0 bits (136), Expect = 1e-07 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -2 Query: 373 VQELRALKASKPFYMQHPATTLTMCPSCEK 284 +QELRALK S+PFYMQ PATTLTMCPSCE+ Sbjct: 111 LQELRALKTSQPFYMQLPATTLTMCPSCER 140 >gb|KHN41711.1| Homeobox-leucine zipper protein HAT14 [Glycine soja] Length = 197 Score = 57.0 bits (136), Expect = 1e-07 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -2 Query: 373 VQELRALKASKPFYMQHPATTLTMCPSCEK 284 +QELRALK S+PFYMQ PATTLTMCPSCE+ Sbjct: 120 LQELRALKTSQPFYMQLPATTLTMCPSCER 149 >ref|XP_006388580.1| hypothetical protein POPTR_0149s00220g [Populus trichocarpa] gi|550310435|gb|ERP47494.1| hypothetical protein POPTR_0149s00220g [Populus trichocarpa] Length = 203 Score = 57.0 bits (136), Expect = 2e-07 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -2 Query: 373 VQELRALKASKPFYMQHPATTLTMCPSCEK 284 +QELRALK S+PFYMQ PATTLTMCPSCE+ Sbjct: 116 LQELRALKTSQPFYMQLPATTLTMCPSCER 145 >ref|XP_009604991.1| PREDICTED: homeobox-leucine zipper protein HOX27-like isoform X4 [Nicotiana tomentosiformis] Length = 252 Score = 57.4 bits (137), Expect = 2e-07 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = -2 Query: 373 VQELRALKASKPFYMQHPATTLTMCPSCEK 284 +QELRALK+S+PFYMQ PATTLTMCPSCE+ Sbjct: 168 LQELRALKSSQPFYMQLPATTLTMCPSCER 197 >emb|CDX81016.1| BnaC03g02700D [Brassica napus] Length = 260 Score = 57.4 bits (137), Expect = 2e-07 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = -2 Query: 373 VQELRALKASKPFYMQHPATTLTMCPSCEK 284 V+ELRALK S PFYMQ PATTLTMCPSCE+ Sbjct: 193 VKELRALKTSSPFYMQRPATTLTMCPSCER 222 >ref|XP_009604990.1| PREDICTED: homeobox-leucine zipper protein HOX11-like isoform X3 [Nicotiana tomentosiformis] Length = 308 Score = 57.4 bits (137), Expect = 2e-07 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = -2 Query: 373 VQELRALKASKPFYMQHPATTLTMCPSCEK 284 +QELRALK+S+PFYMQ PATTLTMCPSCE+ Sbjct: 224 LQELRALKSSQPFYMQLPATTLTMCPSCER 253 >ref|XP_010557949.1| PREDICTED: homeobox-leucine zipper protein HAT14 [Tarenaya hassleriana] Length = 313 Score = 57.4 bits (137), Expect = 2e-07 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -2 Query: 373 VQELRALKASKPFYMQHPATTLTMCPSCEK 284 +QELRALK S+PFYMQ PATTLTMCPSCE+ Sbjct: 254 LQELRALKTSRPFYMQLPATTLTMCPSCER 283 >ref|XP_009604989.1| PREDICTED: homeobox-leucine zipper protein HOX11-like isoform X2 [Nicotiana tomentosiformis] Length = 315 Score = 57.4 bits (137), Expect = 2e-07 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = -2 Query: 373 VQELRALKASKPFYMQHPATTLTMCPSCEK 284 +QELRALK+S+PFYMQ PATTLTMCPSCE+ Sbjct: 231 LQELRALKSSQPFYMQLPATTLTMCPSCER 260 >ref|XP_009604988.1| PREDICTED: homeobox-leucine zipper protein HOX11-like isoform X1 [Nicotiana tomentosiformis] Length = 316 Score = 57.4 bits (137), Expect = 2e-07 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = -2 Query: 373 VQELRALKASKPFYMQHPATTLTMCPSCEK 284 +QELRALK+S+PFYMQ PATTLTMCPSCE+ Sbjct: 232 LQELRALKSSQPFYMQLPATTLTMCPSCER 261 >ref|XP_009130954.1| PREDICTED: homeobox-leucine zipper protein HAT14-like [Brassica rapa] Length = 322 Score = 57.4 bits (137), Expect = 2e-07 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = -2 Query: 373 VQELRALKASKPFYMQHPATTLTMCPSCEK 284 V+ELRALK S PFYMQ PATTLTMCPSCE+ Sbjct: 255 VKELRALKTSSPFYMQRPATTLTMCPSCER 284 >ref|XP_013723745.1| PREDICTED: homeobox-leucine zipper protein HAT14-like [Brassica napus] gi|674876593|emb|CDY55775.1| BnaA03g55490D [Brassica napus] Length = 322 Score = 57.4 bits (137), Expect = 2e-07 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = -2 Query: 373 VQELRALKASKPFYMQHPATTLTMCPSCEK 284 V+ELRALK S PFYMQ PATTLTMCPSCE+ Sbjct: 255 VKELRALKTSSPFYMQRPATTLTMCPSCER 284 >ref|XP_008351552.1| PREDICTED: homeobox-leucine zipper protein HAT14-like [Malus domestica] Length = 250 Score = 57.0 bits (136), Expect = 2e-07 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -2 Query: 373 VQELRALKASKPFYMQHPATTLTMCPSCEK 284 +QELRALK S+PFYMQ PATTLTMCPSCE+ Sbjct: 174 LQELRALKTSQPFYMQLPATTLTMCPSCER 203 >emb|CBI30005.3| unnamed protein product [Vitis vinifera] Length = 250 Score = 57.0 bits (136), Expect = 2e-07 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -2 Query: 373 VQELRALKASKPFYMQHPATTLTMCPSCEK 284 +QELRALK S+PFYMQ PATTLTMCPSCE+ Sbjct: 176 LQELRALKTSQPFYMQLPATTLTMCPSCER 205 >ref|XP_003533912.1| PREDICTED: homeobox-leucine zipper protein HOX11-like [Glycine max] gi|734410763|gb|KHN35655.1| Homeobox-leucine zipper protein HAT14 [Glycine soja] gi|947089418|gb|KRH38083.1| hypothetical protein GLYMA_09G109700 [Glycine max] Length = 327 Score = 57.4 bits (137), Expect = 2e-07 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = -2 Query: 373 VQELRALKASKPFYMQHPATTLTMCPSCEK 284 +QELRALK+S+PFYMQ PATTLTMCPSCE+ Sbjct: 247 LQELRALKSSQPFYMQLPATTLTMCPSCER 276