BLASTX nr result
ID: Rehmannia28_contig00046802
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00046802 (535 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010098426.1| hypothetical protein L484_012141 [Morus nota... 54 4e-07 >ref|XP_010098426.1| hypothetical protein L484_012141 [Morus notabilis] gi|587886196|gb|EXB75017.1| hypothetical protein L484_012141 [Morus notabilis] Length = 62 Score = 54.3 bits (129), Expect = 4e-07 Identities = 31/46 (67%), Positives = 34/46 (73%), Gaps = 1/46 (2%) Frame = +2 Query: 2 VGPVG*RLPFFFSS-RVISQRLANVRKKGEHAHLQNAVQQRVVCCV 136 VGP G FFF VISQRLA VRKKG AHL++AVQ+RVVCCV Sbjct: 14 VGPGGSLNAFFFLLIGVISQRLAMVRKKGGEAHLESAVQRRVVCCV 59