BLASTX nr result
ID: Rehmannia28_contig00046723
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00046723 (335 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU33400.1| hypothetical protein MIMGU_mgv1a023529mg [Erythra... 68 4e-11 ref|XP_012842259.1| PREDICTED: pentatricopeptide repeat-containi... 68 4e-11 ref|XP_011096622.1| PREDICTED: pentatricopeptide repeat-containi... 64 7e-10 ref|XP_012092557.1| PREDICTED: pentatricopeptide repeat-containi... 54 4e-06 gb|KDO75350.1| hypothetical protein CISIN_1g037695mg [Citrus sin... 53 8e-06 ref|XP_006468264.1| PREDICTED: pentatricopeptide repeat-containi... 53 8e-06 ref|XP_006448964.1| hypothetical protein CICLE_v10014263mg [Citr... 53 8e-06 >gb|EYU33400.1| hypothetical protein MIMGU_mgv1a023529mg [Erythranthe guttata] Length = 767 Score = 67.8 bits (164), Expect = 4e-11 Identities = 31/39 (79%), Positives = 36/39 (92%) Frame = +1 Query: 1 LCEEVSKKMILLQKSDEADKLMLRFVERGHVPPKGKQAA 117 LCEEVSKK+IL QK DEADKL+LRFVERGH+PP+GK+ A Sbjct: 727 LCEEVSKKLILQQKFDEADKLILRFVERGHIPPEGKKPA 765 >ref|XP_012842259.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900 [Erythranthe guttata] Length = 814 Score = 67.8 bits (164), Expect = 4e-11 Identities = 31/39 (79%), Positives = 36/39 (92%) Frame = +1 Query: 1 LCEEVSKKMILLQKSDEADKLMLRFVERGHVPPKGKQAA 117 LCEEVSKK+IL QK DEADKL+LRFVERGH+PP+GK+ A Sbjct: 774 LCEEVSKKLILQQKFDEADKLILRFVERGHIPPEGKKPA 812 >ref|XP_011096622.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900 [Sesamum indicum] Length = 798 Score = 64.3 bits (155), Expect = 7e-10 Identities = 31/39 (79%), Positives = 35/39 (89%) Frame = +1 Query: 1 LCEEVSKKMILLQKSDEADKLMLRFVERGHVPPKGKQAA 117 LCEEVSKK+IL QK DEAD+LMLRFVERG+VP K KQA+ Sbjct: 758 LCEEVSKKLILQQKLDEADRLMLRFVERGYVPSKDKQAS 796 >ref|XP_012092557.1| PREDICTED: pentatricopeptide repeat-containing protein At3g04760, chloroplastic [Jatropha curcas] gi|802795643|ref|XP_012092558.1| PREDICTED: pentatricopeptide repeat-containing protein At3g04760, chloroplastic [Jatropha curcas] gi|802795647|ref|XP_012092559.1| PREDICTED: pentatricopeptide repeat-containing protein At3g04760, chloroplastic [Jatropha curcas] gi|643702015|gb|KDP20455.1| hypothetical protein JCGZ_05300 [Jatropha curcas] Length = 833 Score = 53.5 bits (127), Expect = 4e-06 Identities = 25/38 (65%), Positives = 32/38 (84%) Frame = +1 Query: 1 LCEEVSKKMILLQKSDEADKLMLRFVERGHVPPKGKQA 114 LCE+VSKK++L KS+EADKL LRFVERG+ P G+Q+ Sbjct: 793 LCEKVSKKLLLEGKSEEADKLSLRFVERGNTSPCGRQS 830 >gb|KDO75350.1| hypothetical protein CISIN_1g037695mg [Citrus sinensis] Length = 701 Score = 52.8 bits (125), Expect = 8e-06 Identities = 23/37 (62%), Positives = 32/37 (86%) Frame = +1 Query: 1 LCEEVSKKMILLQKSDEADKLMLRFVERGHVPPKGKQ 111 LC++VS+++IL KS+EAD LMLRFVERGH+ PK ++ Sbjct: 654 LCKKVSERLILEGKSEEADTLMLRFVERGHIQPKSEE 690 >ref|XP_006468264.1| PREDICTED: pentatricopeptide repeat-containing protein At5g16640, mitochondrial [Citrus sinensis] Length = 837 Score = 52.8 bits (125), Expect = 8e-06 Identities = 23/37 (62%), Positives = 32/37 (86%) Frame = +1 Query: 1 LCEEVSKKMILLQKSDEADKLMLRFVERGHVPPKGKQ 111 LC++VS+++IL KS+EAD LMLRFVERGH+ PK ++ Sbjct: 797 LCKKVSERLILEGKSEEADTLMLRFVERGHIQPKSEE 833 >ref|XP_006448964.1| hypothetical protein CICLE_v10014263mg [Citrus clementina] gi|557551575|gb|ESR62204.1| hypothetical protein CICLE_v10014263mg [Citrus clementina] Length = 837 Score = 52.8 bits (125), Expect = 8e-06 Identities = 23/37 (62%), Positives = 32/37 (86%) Frame = +1 Query: 1 LCEEVSKKMILLQKSDEADKLMLRFVERGHVPPKGKQ 111 LC++VS+++IL KS+EAD LMLRFVERGH+ PK ++ Sbjct: 797 LCKKVSERLILEGKSEEADTLMLRFVERGHIQPKSEE 833