BLASTX nr result
ID: Rehmannia28_contig00046722
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00046722 (388 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU33400.1| hypothetical protein MIMGU_mgv1a023529mg [Erythra... 66 3e-10 ref|XP_012842259.1| PREDICTED: pentatricopeptide repeat-containi... 66 3e-10 ref|XP_011096622.1| PREDICTED: pentatricopeptide repeat-containi... 63 5e-09 >gb|EYU33400.1| hypothetical protein MIMGU_mgv1a023529mg [Erythranthe guttata] Length = 767 Score = 66.2 bits (160), Expect = 3e-10 Identities = 32/39 (82%), Positives = 35/39 (89%) Frame = +1 Query: 1 LCEEVSKKLILLQKSDEADKLILRFVERGHVPPKVKQAA 117 LCEEVSKKLIL QK DEADKLILRFVERGH+PP+ K+ A Sbjct: 727 LCEEVSKKLILQQKFDEADKLILRFVERGHIPPEGKKPA 765 >ref|XP_012842259.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900 [Erythranthe guttata] Length = 814 Score = 66.2 bits (160), Expect = 3e-10 Identities = 32/39 (82%), Positives = 35/39 (89%) Frame = +1 Query: 1 LCEEVSKKLILLQKSDEADKLILRFVERGHVPPKVKQAA 117 LCEEVSKKLIL QK DEADKLILRFVERGH+PP+ K+ A Sbjct: 774 LCEEVSKKLILQQKFDEADKLILRFVERGHIPPEGKKPA 812 >ref|XP_011096622.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900 [Sesamum indicum] Length = 798 Score = 62.8 bits (151), Expect = 5e-09 Identities = 31/39 (79%), Positives = 35/39 (89%) Frame = +1 Query: 1 LCEEVSKKLILLQKSDEADKLILRFVERGHVPPKVKQAA 117 LCEEVSKKLIL QK DEAD+L+LRFVERG+VP K KQA+ Sbjct: 758 LCEEVSKKLILQQKLDEADRLMLRFVERGYVPSKDKQAS 796