BLASTX nr result
ID: Rehmannia28_contig00046696
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00046696 (337 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010468460.1| PREDICTED: uncharacterized protein LOC104748... 50 7e-06 >ref|XP_010468460.1| PREDICTED: uncharacterized protein LOC104748533 [Camelina sativa] Length = 318 Score = 50.1 bits (118), Expect(2) = 7e-06 Identities = 27/65 (41%), Positives = 39/65 (60%), Gaps = 8/65 (12%) Frame = +3 Query: 87 IVTNPRGI*QGDPISSYLFIILFEVFSNLFHQPRLHLCFFGLKICKIAPSI--------T 242 +VT RG+ QG+P+SSYLFI+ EV S L Q + +K+C+ +PSI T Sbjct: 79 LVTPSRGLRQGEPLSSYLFILCTEVLSGLCVQAQNQGLLPDIKVCRASPSINHLLIVDDT 138 Query: 243 LFFCR 257 +FFC+ Sbjct: 139 MFFCK 143 Score = 26.6 bits (57), Expect(2) = 7e-06 Identities = 13/23 (56%), Positives = 15/23 (65%) Frame = +1 Query: 19 IRACVCSVSFSFNISGQVYGYVT 87 I CV SVS+SF I+G G VT Sbjct: 59 ILTCVSSVSYSFLINGTPQGLVT 81