BLASTX nr result
ID: Rehmannia28_contig00046495
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00046495 (410 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012837094.1| PREDICTED: B-box zinc finger protein 20 isof... 66 1e-10 ref|XP_012837095.1| PREDICTED: B-box zinc finger protein 20 isof... 66 1e-10 gb|EYU37841.1| hypothetical protein MIMGU_mgv1a011874mg [Erythra... 66 2e-10 ref|XP_010066201.1| PREDICTED: B-box zinc finger protein 20-like... 63 1e-09 ref|XP_010066200.1| PREDICTED: B-box zinc finger protein 20-like... 63 3e-09 ref|XP_002305454.2| hypothetical protein POPTR_0004s16810g, part... 63 4e-09 ref|XP_011088466.1| PREDICTED: B-box zinc finger protein 20 [Ses... 62 4e-09 ref|XP_012449911.1| PREDICTED: B-box zinc finger protein 20-like... 60 7e-09 ref|XP_014629884.1| PREDICTED: B-box zinc finger protein 20-like... 61 7e-09 ref|XP_003527146.1| PREDICTED: B-box zinc finger protein 20 isof... 61 8e-09 ref|XP_006487330.1| PREDICTED: B-box zinc finger protein 20 isof... 61 8e-09 ref|XP_006423431.1| hypothetical protein CICLE_v10029294mg [Citr... 61 8e-09 ref|XP_006487329.1| PREDICTED: B-box zinc finger protein 20 isof... 61 9e-09 ref|XP_011037185.1| PREDICTED: B-box zinc finger protein 20-like... 61 9e-09 ref|XP_011047588.1| PREDICTED: B-box zinc finger protein 20-like... 61 1e-08 ref|XP_015892379.1| PREDICTED: B-box zinc finger protein 20 isof... 60 1e-08 ref|XP_006581111.1| PREDICTED: B-box zinc finger protein 20 isof... 61 1e-08 emb|CDO97003.1| unnamed protein product [Coffea canephora] 61 1e-08 ref|XP_012449903.1| PREDICTED: B-box zinc finger protein 20-like... 60 1e-08 ref|XP_002313769.1| zinc finger family protein [Populus trichoca... 60 1e-08 >ref|XP_012837094.1| PREDICTED: B-box zinc finger protein 20 isoform X1 [Erythranthe guttata] Length = 201 Score = 65.9 bits (159), Expect = 1e-10 Identities = 28/37 (75%), Positives = 34/37 (91%) Frame = -1 Query: 122 LLQKRQALLICQEDGALLCRECNIPIHKSNELTQKHN 12 + Q+RQALL CQED ALLCREC+IPIH++NELT+KHN Sbjct: 60 ICQERQALLFCQEDRALLCRECDIPIHRANELTKKHN 96 >ref|XP_012837095.1| PREDICTED: B-box zinc finger protein 20 isoform X2 [Erythranthe guttata] Length = 208 Score = 65.9 bits (159), Expect = 1e-10 Identities = 28/37 (75%), Positives = 34/37 (91%) Frame = -1 Query: 122 LLQKRQALLICQEDGALLCRECNIPIHKSNELTQKHN 12 + Q+RQALL CQED ALLCREC+IPIH++NELT+KHN Sbjct: 60 ICQERQALLFCQEDRALLCRECDIPIHRANELTKKHN 96 >gb|EYU37841.1| hypothetical protein MIMGU_mgv1a011874mg [Erythranthe guttata] Length = 268 Score = 65.9 bits (159), Expect = 2e-10 Identities = 28/37 (75%), Positives = 34/37 (91%) Frame = -1 Query: 122 LLQKRQALLICQEDGALLCRECNIPIHKSNELTQKHN 12 + Q+RQALL CQED ALLCREC+IPIH++NELT+KHN Sbjct: 127 ICQERQALLFCQEDRALLCRECDIPIHRANELTKKHN 163 >ref|XP_010066201.1| PREDICTED: B-box zinc finger protein 20-like isoform X2 [Eucalyptus grandis] Length = 200 Score = 63.2 bits (152), Expect = 1e-09 Identities = 26/37 (70%), Positives = 33/37 (89%) Frame = -1 Query: 122 LLQKRQALLICQEDGALLCRECNIPIHKSNELTQKHN 12 + Q+R+ALL CQED A+LCREC++PIH+SNE TQKHN Sbjct: 60 ICQERRALLFCQEDRAILCRECDVPIHRSNEHTQKHN 96 >ref|XP_010066200.1| PREDICTED: B-box zinc finger protein 20-like isoform X1 [Eucalyptus grandis] gi|629098271|gb|KCW64036.1| hypothetical protein EUGRSUZ_G01710 [Eucalyptus grandis] Length = 293 Score = 63.2 bits (152), Expect = 3e-09 Identities = 26/37 (70%), Positives = 33/37 (89%) Frame = -1 Query: 122 LLQKRQALLICQEDGALLCRECNIPIHKSNELTQKHN 12 + Q+R+ALL CQED A+LCREC++PIH+SNE TQKHN Sbjct: 60 ICQERRALLFCQEDRAILCRECDVPIHRSNEHTQKHN 96 >ref|XP_002305454.2| hypothetical protein POPTR_0004s16810g, partial [Populus trichocarpa] gi|550341192|gb|EEE85965.2| hypothetical protein POPTR_0004s16810g, partial [Populus trichocarpa] Length = 299 Score = 62.8 bits (151), Expect = 4e-09 Identities = 26/37 (70%), Positives = 33/37 (89%) Frame = -1 Query: 122 LLQKRQALLICQEDGALLCRECNIPIHKSNELTQKHN 12 + Q+R+ALL CQED A+LCREC++PIHK+NE TQKHN Sbjct: 60 ICQERRALLFCQEDRAILCRECDLPIHKANEHTQKHN 96 >ref|XP_011088466.1| PREDICTED: B-box zinc finger protein 20 [Sesamum indicum] Length = 197 Score = 61.6 bits (148), Expect = 4e-09 Identities = 26/37 (70%), Positives = 33/37 (89%) Frame = -1 Query: 122 LLQKRQALLICQEDGALLCRECNIPIHKSNELTQKHN 12 + Q+R+ALL CQED ALLCREC+IPIH++NE T+KHN Sbjct: 60 ICQERRALLFCQEDRALLCRECDIPIHRANEHTKKHN 96 >ref|XP_012449911.1| PREDICTED: B-box zinc finger protein 20-like isoform X2 [Gossypium raimondii] Length = 172 Score = 60.5 bits (145), Expect = 7e-09 Identities = 25/37 (67%), Positives = 32/37 (86%) Frame = -1 Query: 122 LLQKRQALLICQEDGALLCRECNIPIHKSNELTQKHN 12 + Q+++ALL CQED A+LCREC+IPIHK+NE T KHN Sbjct: 64 ICQEKRALLFCQEDRAILCRECDIPIHKANEQTTKHN 100 >ref|XP_014629884.1| PREDICTED: B-box zinc finger protein 20-like isoform X2 [Glycine max] Length = 195 Score = 60.8 bits (146), Expect = 7e-09 Identities = 25/37 (67%), Positives = 32/37 (86%) Frame = -1 Query: 122 LLQKRQALLICQEDGALLCRECNIPIHKSNELTQKHN 12 + Q+R+A L CQED ALLCREC++PIH++NE TQKHN Sbjct: 60 ICQERRAYLFCQEDRALLCRECDVPIHRANEHTQKHN 96 >ref|XP_003527146.1| PREDICTED: B-box zinc finger protein 20 isoform X2 [Glycine max] gi|947103094|gb|KRH51477.1| hypothetical protein GLYMA_06G009100 [Glycine max] Length = 200 Score = 60.8 bits (146), Expect = 8e-09 Identities = 25/37 (67%), Positives = 32/37 (86%) Frame = -1 Query: 122 LLQKRQALLICQEDGALLCRECNIPIHKSNELTQKHN 12 + Q+R+A L CQED ALLCREC++PIH++NE TQKHN Sbjct: 60 ICQERRAYLFCQEDRALLCRECDVPIHRANEHTQKHN 96 >ref|XP_006487330.1| PREDICTED: B-box zinc finger protein 20 isoform X3 [Citrus sinensis] Length = 202 Score = 60.8 bits (146), Expect = 8e-09 Identities = 25/37 (67%), Positives = 33/37 (89%) Frame = -1 Query: 122 LLQKRQALLICQEDGALLCRECNIPIHKSNELTQKHN 12 + Q+R+ALL CQED A+LCREC+IPIHK++E T+KHN Sbjct: 60 ICQERRALLFCQEDRAILCRECDIPIHKASEYTKKHN 96 >ref|XP_006423431.1| hypothetical protein CICLE_v10029294mg [Citrus clementina] gi|557525365|gb|ESR36671.1| hypothetical protein CICLE_v10029294mg [Citrus clementina] Length = 205 Score = 60.8 bits (146), Expect = 8e-09 Identities = 25/37 (67%), Positives = 33/37 (89%) Frame = -1 Query: 122 LLQKRQALLICQEDGALLCRECNIPIHKSNELTQKHN 12 + Q+R+ALL CQED A+LCREC+IPIHK++E T+KHN Sbjct: 60 ICQERRALLFCQEDRAILCRECDIPIHKASEYTKKHN 96 >ref|XP_006487329.1| PREDICTED: B-box zinc finger protein 20 isoform X2 [Citrus sinensis] Length = 206 Score = 60.8 bits (146), Expect = 9e-09 Identities = 25/37 (67%), Positives = 33/37 (89%) Frame = -1 Query: 122 LLQKRQALLICQEDGALLCRECNIPIHKSNELTQKHN 12 + Q+R+ALL CQED A+LCREC+IPIHK++E T+KHN Sbjct: 60 ICQERRALLFCQEDRAILCRECDIPIHKASEYTKKHN 96 >ref|XP_011037185.1| PREDICTED: B-box zinc finger protein 20-like [Populus euphratica] Length = 214 Score = 60.8 bits (146), Expect = 9e-09 Identities = 25/37 (67%), Positives = 32/37 (86%) Frame = -1 Query: 122 LLQKRQALLICQEDGALLCRECNIPIHKSNELTQKHN 12 + Q+R+ALL CQED A+LCREC++PIHK+NE QKHN Sbjct: 62 ICQERRALLFCQEDRAILCRECDLPIHKANEHAQKHN 98 >ref|XP_011047588.1| PREDICTED: B-box zinc finger protein 20-like [Populus euphratica] Length = 217 Score = 60.8 bits (146), Expect = 1e-08 Identities = 25/37 (67%), Positives = 32/37 (86%) Frame = -1 Query: 122 LLQKRQALLICQEDGALLCRECNIPIHKSNELTQKHN 12 + Q+R+A+L CQED A+LCREC++PIHK NE TQKHN Sbjct: 62 ICQERRAVLFCQEDRAILCRECDVPIHKVNEHTQKHN 98 >ref|XP_015892379.1| PREDICTED: B-box zinc finger protein 20 isoform X2 [Ziziphus jujuba] Length = 200 Score = 60.5 bits (145), Expect = 1e-08 Identities = 25/37 (67%), Positives = 31/37 (83%) Frame = -1 Query: 122 LLQKRQALLICQEDGALLCRECNIPIHKSNELTQKHN 12 + Q+R+A L CQED A+LCREC+ PIHK+NE TQKHN Sbjct: 60 ICQERRAFLFCQEDRAILCRECDFPIHKANEHTQKHN 96 >ref|XP_006581111.1| PREDICTED: B-box zinc finger protein 20 isoform X1 [Glycine max] gi|734373014|gb|KHN20039.1| Putative salt tolerance-like protein [Glycine soja] gi|947103093|gb|KRH51476.1| hypothetical protein GLYMA_06G009100 [Glycine max] Length = 233 Score = 60.8 bits (146), Expect = 1e-08 Identities = 25/37 (67%), Positives = 32/37 (86%) Frame = -1 Query: 122 LLQKRQALLICQEDGALLCRECNIPIHKSNELTQKHN 12 + Q+R+A L CQED ALLCREC++PIH++NE TQKHN Sbjct: 60 ICQERRAYLFCQEDRALLCRECDVPIHRANEHTQKHN 96 >emb|CDO97003.1| unnamed protein product [Coffea canephora] Length = 235 Score = 60.8 bits (146), Expect = 1e-08 Identities = 25/37 (67%), Positives = 33/37 (89%) Frame = -1 Query: 122 LLQKRQALLICQEDGALLCRECNIPIHKSNELTQKHN 12 + Q+R+A+L CQ+D ALLCREC+IPIHK+N+ TQKHN Sbjct: 60 ICQERRAVLFCQQDRALLCRECDIPIHKANQHTQKHN 96 >ref|XP_012449903.1| PREDICTED: B-box zinc finger protein 20-like isoform X1 [Gossypium raimondii] gi|763744741|gb|KJB12180.1| hypothetical protein B456_002G004700 [Gossypium raimondii] Length = 207 Score = 60.5 bits (145), Expect = 1e-08 Identities = 25/37 (67%), Positives = 32/37 (86%) Frame = -1 Query: 122 LLQKRQALLICQEDGALLCRECNIPIHKSNELTQKHN 12 + Q+++ALL CQED A+LCREC+IPIHK+NE T KHN Sbjct: 64 ICQEKRALLFCQEDRAILCRECDIPIHKANEQTTKHN 100 >ref|XP_002313769.1| zinc finger family protein [Populus trichocarpa] gi|222850177|gb|EEE87724.1| zinc finger family protein [Populus trichocarpa] Length = 215 Score = 60.5 bits (145), Expect = 1e-08 Identities = 25/37 (67%), Positives = 32/37 (86%) Frame = -1 Query: 122 LLQKRQALLICQEDGALLCRECNIPIHKSNELTQKHN 12 + Q+R+A+L CQED A+LCREC++PIHK NE TQKHN Sbjct: 60 ICQERRAVLFCQEDRAILCRECDLPIHKVNEHTQKHN 96