BLASTX nr result
ID: Rehmannia28_contig00045979
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00045979 (335 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP05100.1| unnamed protein product [Coffea canephora] 57 3e-07 ref|XP_011076033.1| PREDICTED: ethylene-responsive transcription... 55 2e-06 ref|XP_012852036.1| PREDICTED: ethylene-responsive transcription... 54 4e-06 >emb|CDP05100.1| unnamed protein product [Coffea canephora] Length = 390 Score = 56.6 bits (135), Expect = 3e-07 Identities = 27/35 (77%), Positives = 32/35 (91%), Gaps = 2/35 (5%) Frame = -1 Query: 335 DVNDSFQELGSLE--VDDYFQDMNDFASADALLAI 237 ++NDSFQ+ GS+E VDDYFQDMNDFASADALLA+ Sbjct: 356 ELNDSFQDFGSVELNVDDYFQDMNDFASADALLAV 390 >ref|XP_011076033.1| PREDICTED: ethylene-responsive transcription factor CRF4-like [Sesamum indicum] Length = 401 Score = 54.7 bits (130), Expect = 2e-06 Identities = 25/33 (75%), Positives = 29/33 (87%) Frame = -1 Query: 335 DVNDSFQELGSLEVDDYFQDMNDFASADALLAI 237 D+ DSFQEL +LEV+DYFQDM+DF S DALLAI Sbjct: 369 DIKDSFQELCTLEVEDYFQDMSDFGSVDALLAI 401 >ref|XP_012852036.1| PREDICTED: ethylene-responsive transcription factor CRF4 [Erythranthe guttata] gi|604306136|gb|EYU25193.1| hypothetical protein MIMGU_mgv1a018883mg [Erythranthe guttata] Length = 399 Score = 53.5 bits (127), Expect = 4e-06 Identities = 24/33 (72%), Positives = 27/33 (81%) Frame = -1 Query: 335 DVNDSFQELGSLEVDDYFQDMNDFASADALLAI 237 D+ DSFQEL SLEV+DYFQD+ DF DALLAI Sbjct: 367 DIKDSFQELDSLEVEDYFQDLTDFGGVDALLAI 399