BLASTX nr result
ID: Rehmannia28_contig00045904
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00045904 (351 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011102135.1| PREDICTED: pentatricopeptide repeat-containi... 55 1e-06 ref|XP_009780195.1| PREDICTED: pentatricopeptide repeat-containi... 54 3e-06 ref|XP_009618316.1| PREDICTED: pentatricopeptide repeat-containi... 54 3e-06 >ref|XP_011102135.1| PREDICTED: pentatricopeptide repeat-containing protein At2g27610-like [Sesamum indicum] Length = 588 Score = 55.5 bits (132), Expect = 1e-06 Identities = 26/53 (49%), Positives = 36/53 (67%), Gaps = 1/53 (1%) Frame = +1 Query: 1 RRIHERIYRAEVNINSFLFNCLVKFYGKCGLLKFTKVVSN-VQSLSTIDCVSL 156 + IH RIYR E +NSF+ N LV YGKCGLLK ++V + + ++ + CVSL Sbjct: 62 KEIHGRIYRREETVNSFVNNSLVNLYGKCGLLKSARLVFDAIPEINAVSCVSL 114 >ref|XP_009780195.1| PREDICTED: pentatricopeptide repeat-containing protein At3g53360, mitochondrial-like [Nicotiana sylvestris] Length = 698 Score = 54.3 bits (129), Expect = 3e-06 Identities = 22/38 (57%), Positives = 30/38 (78%) Frame = +1 Query: 1 RRIHERIYRAEVNINSFLFNCLVKFYGKCGLLKFTKVV 114 + +H R+YR E ++NSF+ NCLV FYGKCGLLK ++V Sbjct: 122 KELHGRMYRTEESLNSFVTNCLVNFYGKCGLLKSARLV 159 >ref|XP_009618316.1| PREDICTED: pentatricopeptide repeat-containing protein At3g53360, mitochondrial-like [Nicotiana tomentosiformis] Length = 698 Score = 54.3 bits (129), Expect = 3e-06 Identities = 22/38 (57%), Positives = 30/38 (78%) Frame = +1 Query: 1 RRIHERIYRAEVNINSFLFNCLVKFYGKCGLLKFTKVV 114 + +H R+YR E ++NSF+ NCLV FYGKCGLLK ++V Sbjct: 122 KELHGRMYRTEESLNSFVTNCLVNFYGKCGLLKSARLV 159