BLASTX nr result
ID: Rehmannia28_contig00045747
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00045747 (322 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011076754.1| PREDICTED: uncharacterized protein LOC105160... 67 9e-11 ref|XP_012858381.1| PREDICTED: transcriptional activator Myb-lik... 60 1e-08 >ref|XP_011076754.1| PREDICTED: uncharacterized protein LOC105160924 [Sesamum indicum] Length = 462 Score = 66.6 bits (161), Expect = 9e-11 Identities = 31/56 (55%), Positives = 43/56 (76%) Frame = +2 Query: 2 IMPANTSVHVNMEENLKNGQLVFEGRNLFSGMTREVINTQMTVPTFTLQAQVEGLS 169 I+PA +H++MEEN+KN + + E RNLF+G TR+V + Q +PT TL+AQVEGLS Sbjct: 407 IIPACAPMHMDMEENVKNDKFLLEERNLFAGTTRDVASNQRMMPTLTLRAQVEGLS 462 >ref|XP_012858381.1| PREDICTED: transcriptional activator Myb-like [Erythranthe guttata] Length = 412 Score = 60.5 bits (145), Expect = 1e-08 Identities = 26/44 (59%), Positives = 39/44 (88%) Frame = +2 Query: 38 EENLKNGQLVFEGRNLFSGMTREVINTQMTVPTFTLQAQVEGLS 169 E+++KN Q++F+ +N+F+G+TREV T+M++PTFTLQ QVEGLS Sbjct: 369 EDSVKNDQMIFDRQNVFTGVTREVGTTKMSMPTFTLQTQVEGLS 412