BLASTX nr result
ID: Rehmannia28_contig00045603
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00045603 (316 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011081421.1| PREDICTED: PTI1-like tyrosine-protein kinase... 57 3e-07 ref|XP_012852775.1| PREDICTED: PTI1-like tyrosine-protein kinase... 52 8e-06 >ref|XP_011081421.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890 [Sesamum indicum] Length = 360 Score = 56.6 bits (135), Expect = 3e-07 Identities = 24/30 (80%), Positives = 25/30 (83%) Frame = -2 Query: 90 VMDFFSMLCCVTGSDRKNQGKNDSKWRIFS 1 +MDFFS CCV GSDRKNQGK DS WRIFS Sbjct: 1 MMDFFSKFCCVKGSDRKNQGKKDSTWRIFS 30 >ref|XP_012852775.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890 [Erythranthe guttata] gi|848907243|ref|XP_012852776.1| PREDICTED: PTI1-like tyrosine-protein kinase At3g15890 [Erythranthe guttata] gi|604305493|gb|EYU24637.1| hypothetical protein MIMGU_mgv1a009016mg [Erythranthe guttata] Length = 355 Score = 52.4 bits (124), Expect = 8e-06 Identities = 22/29 (75%), Positives = 23/29 (79%) Frame = -2 Query: 87 MDFFSMLCCVTGSDRKNQGKNDSKWRIFS 1 M FFSM CCV GSDRK QGK D +WRIFS Sbjct: 1 MGFFSMFCCVKGSDRKKQGKKDPEWRIFS 29