BLASTX nr result
ID: Rehmannia28_contig00045561
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00045561 (426 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAF64710.1| putative transposase [Ipomoea tricolor] 54 4e-06 >dbj|BAF64710.1| putative transposase [Ipomoea tricolor] Length = 517 Score = 53.9 bits (128), Expect(2) = 4e-06 Identities = 27/89 (30%), Positives = 46/89 (51%) Frame = +3 Query: 156 EVKVSNTYHVTKMILNGDIEEISDFKKRDCRSNNPARSISYVSFPVARSIPDDLASGESP 335 ++KV +++ VT++ +N D E +F+ R P RSI +S S +D +SG+ Sbjct: 218 DIKVCSSFDVTQIWVNSDFPEFQEFRDRLKGEQTPMRSIVSMSNMSYGSAFEDFSSGQMN 277 Query: 336 FRLIDQLYANEEVGSFWISATIFSFIGDW 422 I ++Y +E G FW++A I W Sbjct: 278 VFTISEIYQKKEYGDFWVAAKIVGIESSW 306 Score = 23.5 bits (49), Expect(2) = 4e-06 Identities = 8/14 (57%), Positives = 12/14 (85%) Frame = +2 Query: 98 EPLIMILQMCRAKV 139 +P+I++LQ CR KV Sbjct: 199 DPVIILLQFCRVKV 212