BLASTX nr result
ID: Rehmannia28_contig00045468
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00045468 (707 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012856066.1| PREDICTED: glutamate receptor 2.7-like [Eryt... 58 2e-06 gb|EYU21239.1| hypothetical protein MIMGU_mgv1a020626mg [Erythra... 58 2e-06 >ref|XP_012856066.1| PREDICTED: glutamate receptor 2.7-like [Erythranthe guttata] Length = 848 Score = 58.2 bits (139), Expect = 2e-06 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = +1 Query: 607 MDTALNLLKDIEVDAIIGPQNSAQANFVIGLGD 705 M ALNLLKD++VDAIIGPQ SAQANFVIGLGD Sbjct: 1 MYAALNLLKDVQVDAIIGPQTSAQANFVIGLGD 33 >gb|EYU21239.1| hypothetical protein MIMGU_mgv1a020626mg [Erythranthe guttata] Length = 925 Score = 58.2 bits (139), Expect = 2e-06 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = +1 Query: 610 DTALNLLKDIEVDAIIGPQNSAQANFVIGLGD 705 ++ALNLLKD++VDAIIGPQ SAQANFVIGLGD Sbjct: 79 NSALNLLKDVQVDAIIGPQTSAQANFVIGLGD 110