BLASTX nr result
ID: Rehmannia28_contig00045423
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00045423 (369 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012849971.1| PREDICTED: lysosomal beta glucosidase-like [... 69 3e-11 ref|XP_011087395.1| PREDICTED: lysosomal beta glucosidase-like [... 67 1e-10 >ref|XP_012849971.1| PREDICTED: lysosomal beta glucosidase-like [Erythranthe guttata] Length = 707 Score = 68.6 bits (166), Expect = 3e-11 Identities = 32/43 (74%), Positives = 35/43 (81%) Frame = +3 Query: 3 FVGLFFQVKRRKLSRSQACMYPRWFWSFLLNHFQNSTMPRGRR 131 F GL+FQVKRRKLSRSQA ++P WF SFLLN FQNS RGRR Sbjct: 658 FAGLYFQVKRRKLSRSQASVWPSWFCSFLLNRFQNSPTQRGRR 700 >ref|XP_011087395.1| PREDICTED: lysosomal beta glucosidase-like [Sesamum indicum] Length = 700 Score = 67.0 bits (162), Expect = 1e-10 Identities = 31/41 (75%), Positives = 34/41 (82%) Frame = +3 Query: 3 FVGLFFQVKRRKLSRSQACMYPRWFWSFLLNHFQNSTMPRG 125 FVGL+FQVKR KLSRS A ++PRW SFLLNHFQNS M RG Sbjct: 653 FVGLYFQVKRTKLSRSPASLFPRWVSSFLLNHFQNSRMARG 693