BLASTX nr result
ID: Rehmannia28_contig00045366
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00045366 (474 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KYP41175.1| Retrovirus-related Pol polyprotein from transposo... 60 3e-09 gb|KYP73844.1| Retrovirus-related Pol polyprotein from transposo... 60 4e-09 ref|XP_012441848.1| PREDICTED: uncharacterized protein LOC105766... 63 8e-09 gb|KYP37734.1| Transposon Ty3-I Gag-Pol polyprotein, partial [Ca... 61 1e-08 gb|KYP31939.1| Retrovirus-related Pol polyprotein from transposo... 60 1e-08 gb|KYP42763.1| Retrovirus-related Pol polyprotein from transposo... 60 1e-08 ref|XP_012466477.1| PREDICTED: uncharacterized protein LOC105785... 62 2e-08 gb|KYP38497.1| Retrovirus-related Pol polyprotein from transposo... 59 2e-08 gb|KYP32008.1| Retrovirus-related Pol polyprotein from transposo... 59 2e-08 ref|XP_012441962.1| PREDICTED: uncharacterized protein LOC105766... 62 2e-08 gb|KYP41174.1| Retrovirus-related Pol polyprotein from transposo... 60 2e-08 gb|KYP35208.1| Retrovirus-related Pol polyprotein from transposo... 61 3e-08 gb|KYP41166.1| Transposon Ty3-I Gag-Pol polyprotein [Cajanus cajan] 60 3e-08 gb|KYP57442.1| Retrovirus-related Pol polyprotein from transposo... 59 3e-08 gb|KYP39206.1| Retrovirus-related Pol polyprotein from transposo... 61 4e-08 gb|KYP42762.1| Transposon Ty3-I Gag-Pol polyprotein, partial [Ca... 60 4e-08 ref|XP_007013973.1| Uncharacterized protein TCM_038545 [Theobrom... 59 4e-08 ref|XP_012441989.1| PREDICTED: uncharacterized protein LOC105767... 61 4e-08 gb|KYP50646.1| Retrovirus-related Pol polyprotein from transposo... 58 4e-08 gb|KYP79146.1| Transposon Ty3-G Gag-Pol polyprotein, partial [Ca... 60 4e-08 >gb|KYP41175.1| Retrovirus-related Pol polyprotein from transposon 297 family [Cajanus cajan] Length = 98 Score = 60.5 bits (145), Expect = 3e-09 Identities = 30/45 (66%), Positives = 35/45 (77%), Gaps = 1/45 (2%) Frame = -1 Query: 225 VLQILREKQLFAKLSKFEFWLENVIFLGHAYD-DDIIVDPQKIEA 94 VLQIL++KQL+AKLSK EFWLE V FLGH D + VDP K+EA Sbjct: 37 VLQILKDKQLYAKLSKCEFWLEEVKFLGHGISKDGVSVDPSKVEA 81 >gb|KYP73844.1| Retrovirus-related Pol polyprotein from transposon 17.6, partial [Cajanus cajan] Length = 114 Score = 60.5 bits (145), Expect = 4e-09 Identities = 30/45 (66%), Positives = 35/45 (77%), Gaps = 1/45 (2%) Frame = -1 Query: 225 VLQILREKQLFAKLSKFEFWLENVIFLGHAYD-DDIIVDPQKIEA 94 VLQIL++KQL+AKLSK EFWLE V FLGH D + VDP K+EA Sbjct: 67 VLQILKDKQLYAKLSKCEFWLEEVKFLGHVISKDGVSVDPSKVEA 111 >ref|XP_012441848.1| PREDICTED: uncharacterized protein LOC105766834 [Gossypium raimondii] Length = 1024 Score = 63.2 bits (152), Expect = 8e-09 Identities = 33/45 (73%), Positives = 36/45 (80%), Gaps = 1/45 (2%) Frame = -1 Query: 225 VLQILREKQLFAKLSKFEFWLENVIFLGHAYD-DDIIVDPQKIEA 94 VLQILREKQL+ KLSK EFWL +VIFLGH D I VDP+KIEA Sbjct: 718 VLQILREKQLYGKLSKCEFWLSDVIFLGHVVSADGIRVDPKKIEA 762 >gb|KYP37734.1| Transposon Ty3-I Gag-Pol polyprotein, partial [Cajanus cajan] Length = 185 Score = 60.8 bits (146), Expect = 1e-08 Identities = 30/45 (66%), Positives = 36/45 (80%), Gaps = 1/45 (2%) Frame = -1 Query: 225 VLQILREKQLFAKLSKFEFWLENVIFLGHAYDD-DIIVDPQKIEA 94 VLQ L+EKQL+AKLSK EFWL+NV FLGH + I+VDP K+EA Sbjct: 130 VLQTLKEKQLYAKLSKCEFWLDNVNFLGHVTSEGGIVVDPAKVEA 174 >gb|KYP31939.1| Retrovirus-related Pol polyprotein from transposon 297 family [Cajanus cajan] Length = 166 Score = 60.5 bits (145), Expect = 1e-08 Identities = 30/45 (66%), Positives = 35/45 (77%), Gaps = 1/45 (2%) Frame = -1 Query: 225 VLQILREKQLFAKLSKFEFWLENVIFLGHAYD-DDIIVDPQKIEA 94 VLQIL++KQL+AKLSK EFWLE V FLGH D + VDP K+EA Sbjct: 37 VLQILKDKQLYAKLSKCEFWLEEVKFLGHVISKDGVSVDPSKVEA 81 >gb|KYP42763.1| Retrovirus-related Pol polyprotein from transposon 297 family [Cajanus cajan] Length = 150 Score = 60.1 bits (144), Expect = 1e-08 Identities = 29/45 (64%), Positives = 35/45 (77%), Gaps = 1/45 (2%) Frame = -1 Query: 225 VLQILREKQLFAKLSKFEFWLENVIFLGHAYD-DDIIVDPQKIEA 94 VLQ+L++KQL+AKLSK EFWLE V FLGH D + VDP K+EA Sbjct: 37 VLQVLKDKQLYAKLSKCEFWLEEVKFLGHVISKDGVSVDPSKVEA 81 >ref|XP_012466477.1| PREDICTED: uncharacterized protein LOC105785086 [Gossypium raimondii] Length = 780 Score = 62.4 bits (150), Expect = 2e-08 Identities = 32/45 (71%), Positives = 35/45 (77%), Gaps = 1/45 (2%) Frame = -1 Query: 225 VLQILREKQLFAKLSKFEFWLENVIFLGHAYD-DDIIVDPQKIEA 94 VLQILREKQL+ KLSK EFWL V+FLGH D I VDP+KIEA Sbjct: 717 VLQILREKQLYGKLSKCEFWLSEVVFLGHVVSADGIRVDPKKIEA 761 >gb|KYP38497.1| Retrovirus-related Pol polyprotein from transposon 17.6 [Cajanus cajan] Length = 102 Score = 58.5 bits (140), Expect = 2e-08 Identities = 28/45 (62%), Positives = 35/45 (77%), Gaps = 1/45 (2%) Frame = -1 Query: 225 VLQILREKQLFAKLSKFEFWLENVIFLGHAYD-DDIIVDPQKIEA 94 VL++LRE+QL+AKLSK EFWL V FLGH + I+VDP K+EA Sbjct: 37 VLEVLRERQLYAKLSKCEFWLSEVRFLGHVISTEGIVVDPTKVEA 81 >gb|KYP32008.1| Retrovirus-related Pol polyprotein from transposon 17.6 [Cajanus cajan] Length = 141 Score = 59.3 bits (142), Expect = 2e-08 Identities = 29/48 (60%), Positives = 36/48 (75%), Gaps = 1/48 (2%) Frame = -1 Query: 234 LIQVLQILREKQLFAKLSKFEFWLENVIFLGHAYD-DDIIVDPQKIEA 94 L VL++LRE+QL+AKLSK+EFWL V FLGH + I VDP K+EA Sbjct: 34 LRSVLEVLRERQLYAKLSKYEFWLSKVKFLGHVISAEGIAVDPAKVEA 81 >ref|XP_012441962.1| PREDICTED: uncharacterized protein LOC105766968 [Gossypium raimondii] Length = 1030 Score = 62.0 bits (149), Expect = 2e-08 Identities = 31/45 (68%), Positives = 36/45 (80%), Gaps = 1/45 (2%) Frame = -1 Query: 225 VLQILREKQLFAKLSKFEFWLENVIFLGHAYDDD-IIVDPQKIEA 94 VLQILREKQL+AK SK+EFWL V FLGH ++ I VDP+KIEA Sbjct: 621 VLQILREKQLYAKFSKYEFWLRKVTFLGHVVSNEGIRVDPRKIEA 665 >gb|KYP41174.1| Retrovirus-related Pol polyprotein from transposon 17.6 [Cajanus cajan] Length = 211 Score = 60.5 bits (145), Expect = 2e-08 Identities = 30/45 (66%), Positives = 35/45 (77%), Gaps = 1/45 (2%) Frame = -1 Query: 225 VLQILREKQLFAKLSKFEFWLENVIFLGHAYD-DDIIVDPQKIEA 94 VLQIL++KQL+AKLSK EFWLE V FLGH D + VDP K+EA Sbjct: 37 VLQILKDKQLYAKLSKCEFWLEEVKFLGHVISKDGVSVDPSKVEA 81 >gb|KYP35208.1| Retrovirus-related Pol polyprotein from transposon 17.6, partial [Cajanus cajan] Length = 300 Score = 61.2 bits (147), Expect = 3e-08 Identities = 29/45 (64%), Positives = 36/45 (80%), Gaps = 1/45 (2%) Frame = -1 Query: 225 VLQILREKQLFAKLSKFEFWLENVIFLGHA-YDDDIIVDPQKIEA 94 VLQIL++KQL+AKLSK EFWLE V FLGH + D + +DP K+EA Sbjct: 134 VLQILKDKQLYAKLSKCEFWLEEVKFLGHVIFKDGVSIDPSKVEA 178 >gb|KYP41166.1| Transposon Ty3-I Gag-Pol polyprotein [Cajanus cajan] Length = 237 Score = 60.5 bits (145), Expect = 3e-08 Identities = 30/45 (66%), Positives = 35/45 (77%), Gaps = 1/45 (2%) Frame = -1 Query: 225 VLQILREKQLFAKLSKFEFWLENVIFLGHAYD-DDIIVDPQKIEA 94 VLQIL++KQL+AKLSK EFWLE V FLGH D + VDP K+EA Sbjct: 171 VLQILKDKQLYAKLSKCEFWLEEVKFLGHVISKDGVSVDPSKVEA 215 >gb|KYP57442.1| Retrovirus-related Pol polyprotein from transposon 297 family [Cajanus cajan] gi|1012350872|gb|KYP62061.1| Retrovirus-related Pol polyprotein from transposon 297 family [Cajanus cajan] Length = 168 Score = 59.3 bits (142), Expect = 3e-08 Identities = 28/45 (62%), Positives = 35/45 (77%), Gaps = 1/45 (2%) Frame = -1 Query: 225 VLQILREKQLFAKLSKFEFWLENVIFLGHAYDDD-IIVDPQKIEA 94 + QIL++KQL+AKLSK EFWLE V FLGH +D + VDP K+EA Sbjct: 53 IFQILKDKQLYAKLSKCEFWLEEVKFLGHVISNDGVSVDPSKVEA 97 >gb|KYP39206.1| Retrovirus-related Pol polyprotein from transposon 17.6 [Cajanus cajan] Length = 557 Score = 61.2 bits (147), Expect = 4e-08 Identities = 29/45 (64%), Positives = 36/45 (80%), Gaps = 1/45 (2%) Frame = -1 Query: 225 VLQILREKQLFAKLSKFEFWLENVIFLGHA-YDDDIIVDPQKIEA 94 VLQIL++KQL+AKLSK EFWLE + FLGH + D + VDP K+EA Sbjct: 317 VLQILKDKQLYAKLSKCEFWLEEIKFLGHVIFKDGVSVDPSKVEA 361 >gb|KYP42762.1| Transposon Ty3-I Gag-Pol polyprotein, partial [Cajanus cajan] Length = 226 Score = 60.1 bits (144), Expect = 4e-08 Identities = 29/45 (64%), Positives = 35/45 (77%), Gaps = 1/45 (2%) Frame = -1 Query: 225 VLQILREKQLFAKLSKFEFWLENVIFLGHAYD-DDIIVDPQKIEA 94 VLQ+L++KQL+AKLSK EFWLE V FLGH D + VDP K+EA Sbjct: 146 VLQVLKDKQLYAKLSKCEFWLEEVKFLGHVISKDGVSVDPSKVEA 190 >ref|XP_007013973.1| Uncharacterized protein TCM_038545 [Theobroma cacao] gi|508784336|gb|EOY31592.1| Uncharacterized protein TCM_038545 [Theobroma cacao] Length = 141 Score = 58.5 bits (140), Expect = 4e-08 Identities = 27/45 (60%), Positives = 36/45 (80%), Gaps = 1/45 (2%) Frame = -1 Query: 225 VLQILREKQLFAKLSKFEFWLENVIFLGHAYDDD-IIVDPQKIEA 94 +LQ+LR+ QL+AK SK EFWL+N+ FLGH D ++VDP+KIEA Sbjct: 49 MLQMLRDHQLYAKFSKCEFWLDNISFLGHVVSKDRVMVDPKKIEA 93 >ref|XP_012441989.1| PREDICTED: uncharacterized protein LOC105767002 [Gossypium raimondii] Length = 1227 Score = 61.2 bits (147), Expect = 4e-08 Identities = 31/45 (68%), Positives = 35/45 (77%), Gaps = 1/45 (2%) Frame = -1 Query: 225 VLQILREKQLFAKLSKFEFWLENVIFLGHAYD-DDIIVDPQKIEA 94 VLQILREKQL+ KL+K EFWL V+FLGH D I VDP+KIEA Sbjct: 585 VLQILREKQLYGKLNKCEFWLSEVVFLGHVVSADGIRVDPKKIEA 629 >gb|KYP50646.1| Retrovirus-related Pol polyprotein from transposon 17.6 [Cajanus cajan] Length = 128 Score = 58.2 bits (139), Expect = 4e-08 Identities = 29/45 (64%), Positives = 35/45 (77%), Gaps = 1/45 (2%) Frame = -1 Query: 225 VLQILREKQLFAKLSKFEFWLENVIFLGHAYDDD-IIVDPQKIEA 94 VLQ L+EKQL+AKLSK EFWL++V FLGH I+VDP K+EA Sbjct: 37 VLQTLKEKQLYAKLSKCEFWLDSVNFLGHVISKGRIVVDPAKVEA 81 >gb|KYP79146.1| Transposon Ty3-G Gag-Pol polyprotein, partial [Cajanus cajan] Length = 278 Score = 60.5 bits (145), Expect = 4e-08 Identities = 30/45 (66%), Positives = 35/45 (77%), Gaps = 1/45 (2%) Frame = -1 Query: 225 VLQILREKQLFAKLSKFEFWLENVIFLGHAYD-DDIIVDPQKIEA 94 VLQIL++KQL+AKLSK EFWLE V FLGH D + VDP K+EA Sbjct: 207 VLQILKDKQLYAKLSKCEFWLEEVKFLGHVISKDGVSVDPSKVEA 251