BLASTX nr result
ID: Rehmannia28_contig00045172
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00045172 (437 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011090170.1| PREDICTED: pentatricopeptide repeat-containi... 81 3e-15 gb|EYU35942.1| hypothetical protein MIMGU_mgv1a002651mg [Erythra... 65 1e-09 ref|XP_012838437.1| PREDICTED: pentatricopeptide repeat-containi... 65 1e-09 >ref|XP_011090170.1| PREDICTED: pentatricopeptide repeat-containing protein At5g01110 [Sesamum indicum] Length = 715 Score = 81.3 bits (199), Expect = 3e-15 Identities = 40/54 (74%), Positives = 46/54 (85%) Frame = -1 Query: 179 MAARRPFFPSKKFTKRTRSFSTHSPINYSSTSPQTLSLDSFLLEKILWALKRGR 18 MAARRPF KKF + TRSFST+SP+N+SS+S QTLS SFLLEKILWALKRG+ Sbjct: 1 MAARRPFIHCKKFARPTRSFSTNSPVNHSSSSAQTLSSASFLLEKILWALKRGQ 54 >gb|EYU35942.1| hypothetical protein MIMGU_mgv1a002651mg [Erythranthe guttata] Length = 650 Score = 65.1 bits (157), Expect = 1e-09 Identities = 35/55 (63%), Positives = 43/55 (78%), Gaps = 1/55 (1%) Frame = -1 Query: 179 MAARRPFFPSKKFTKRTRSFSTHSPINYSST-SPQTLSLDSFLLEKILWALKRGR 18 MAA++PF KKF+ RSFS+ PI+ SST S Q+LS DSFL+EKILWALKRG+ Sbjct: 1 MAAKQPFLHCKKFSLPRRSFSSQIPISCSSTNSQQSLSSDSFLVEKILWALKRGQ 55 >ref|XP_012838437.1| PREDICTED: pentatricopeptide repeat-containing protein At5g01110 [Erythranthe guttata] Length = 716 Score = 65.1 bits (157), Expect = 1e-09 Identities = 35/55 (63%), Positives = 43/55 (78%), Gaps = 1/55 (1%) Frame = -1 Query: 179 MAARRPFFPSKKFTKRTRSFSTHSPINYSST-SPQTLSLDSFLLEKILWALKRGR 18 MAA++PF KKF+ RSFS+ PI+ SST S Q+LS DSFL+EKILWALKRG+ Sbjct: 1 MAAKQPFLHCKKFSLPRRSFSSQIPISCSSTNSQQSLSSDSFLVEKILWALKRGQ 55