BLASTX nr result
ID: Rehmannia28_contig00045071
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00045071 (309 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012837028.1| PREDICTED: TLD domain-containing protein 2 i... 54 3e-06 >ref|XP_012837028.1| PREDICTED: TLD domain-containing protein 2 isoform X1 [Erythranthe guttata] gi|604333420|gb|EYU37771.1| hypothetical protein MIMGU_mgv1a008212mg [Erythranthe guttata] Length = 381 Score = 53.5 bits (127), Expect = 3e-06 Identities = 23/35 (65%), Positives = 30/35 (85%) Frame = -1 Query: 105 MHAIRDRVYEKLSRFFSDSQSCHETIDQDTEASQY 1 MHAI+DRVY+KLS FFSDS++ H T+D ++EA QY Sbjct: 64 MHAIKDRVYDKLSGFFSDSRTSHGTLDHESEARQY 98