BLASTX nr result
ID: Rehmannia28_contig00044801
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00044801 (517 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010255747.1| PREDICTED: acyl-CoA-binding protein [Nelumbo... 52 4e-06 ref|XP_010278803.1| PREDICTED: acyl-CoA-binding protein-like [Ne... 52 5e-06 ref|XP_012070513.1| PREDICTED: acyl-CoA-binding protein [Jatroph... 52 6e-06 >ref|XP_010255747.1| PREDICTED: acyl-CoA-binding protein [Nelumbo nucifera] Length = 90 Score = 52.4 bits (124), Expect = 4e-06 Identities = 26/37 (70%), Positives = 28/37 (75%) Frame = -2 Query: 489 TSHPDMLNMRDRAK*DGRKAVEGKYQEEAISDYTAKV 379 TS P + NMRDRAK D KAVEGK QEEA+SDY KV Sbjct: 43 TSRPGLFNMRDRAKWDAWKAVEGKSQEEAMSDYITKV 79 >ref|XP_010278803.1| PREDICTED: acyl-CoA-binding protein-like [Nelumbo nucifera] Length = 90 Score = 52.0 bits (123), Expect = 5e-06 Identities = 26/37 (70%), Positives = 27/37 (72%) Frame = -2 Query: 489 TSHPDMLNMRDRAK*DGRKAVEGKYQEEAISDYTAKV 379 TS P M NMRDRAK D KAVEGK QEEA+ DY KV Sbjct: 43 TSRPGMFNMRDRAKWDAWKAVEGKSQEEAMGDYITKV 79 >ref|XP_012070513.1| PREDICTED: acyl-CoA-binding protein [Jatropha curcas] gi|284433772|gb|ADB85092.1| acyl-CoA-binding protein [Jatropha curcas] gi|643732667|gb|KDP39763.1| hypothetical protein JCGZ_02783 [Jatropha curcas] gi|748806991|gb|AJE63430.1| acyl-CoA-binding protein [Jatropha curcas] Length = 92 Score = 52.0 bits (123), Expect = 6e-06 Identities = 26/37 (70%), Positives = 28/37 (75%) Frame = -2 Query: 489 TSHPDMLNMRDRAK*DGRKAVEGKYQEEAISDYTAKV 379 TS P M NMRDRAK D KAVEGK +EEA+SDY KV Sbjct: 43 TSRPGMFNMRDRAKWDAWKAVEGKSKEEAMSDYITKV 79