BLASTX nr result
ID: Rehmannia28_contig00043804
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00043804 (406 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012828694.1| PREDICTED: plant cysteine oxidase 2-like [Er... 82 3e-16 ref|XP_011094139.1| PREDICTED: probable 2-aminoethanethiol dioxy... 67 1e-10 gb|KVH90534.1| Cysteamine dioxygenase [Cynara cardunculus var. s... 61 8e-09 ref|XP_002325431.2| hypothetical protein POPTR_0019s05510g [Popu... 57 2e-07 ref|XP_011001703.1| PREDICTED: 2-aminoethanethiol dioxygenase-li... 56 7e-07 gb|KVI00028.1| Cysteamine dioxygenase [Cynara cardunculus var. s... 55 1e-06 gb|EEF36683.1| conserved hypothetical protein [Ricinus communis] 55 1e-06 ref|XP_004493204.1| PREDICTED: plant cysteine oxidase 2-like [Ci... 55 2e-06 ref|XP_010530540.1| PREDICTED: probable 2-aminoethanethiol dioxy... 55 2e-06 ref|XP_012070402.1| PREDICTED: 2-aminoethanethiol dioxygenase-li... 54 4e-06 ref|XP_004489672.1| PREDICTED: plant cysteine oxidase 2-like [Ci... 54 5e-06 ref|XP_013451540.1| 2-aminoethanethiol dioxygenase-like protein ... 53 8e-06 ref|XP_010677795.1| PREDICTED: probable 2-aminoethanethiol dioxy... 53 9e-06 ref|XP_006600234.1| PREDICTED: uncharacterized protein LOC100819... 53 1e-05 >ref|XP_012828694.1| PREDICTED: plant cysteine oxidase 2-like [Erythranthe guttata] gi|604298100|gb|EYU18188.1| hypothetical protein MIMGU_mgv1a010907mg [Erythranthe guttata] Length = 298 Score = 82.0 bits (201), Expect = 3e-16 Identities = 38/52 (73%), Positives = 43/52 (82%) Frame = -3 Query: 404 ETPCDVLLDNEELTKVKDLGGCYRWLEEIEIPKESEMDGIEYMGPQIINSTS 249 ETPC LLD EE+ + K G CYRWLEEIE PKESEMDGIEYMGP+II+ST+ Sbjct: 247 ETPCINLLDREEIEEYKADGSCYRWLEEIETPKESEMDGIEYMGPKIIDSTA 298 >ref|XP_011094139.1| PREDICTED: probable 2-aminoethanethiol dioxygenase [Sesamum indicum] Length = 288 Score = 67.0 bits (162), Expect = 1e-10 Identities = 32/51 (62%), Positives = 37/51 (72%), Gaps = 1/51 (1%) Frame = -3 Query: 404 ETPCDVLLDNEELTKVKD-LGGCYRWLEEIEIPKESEMDGIEYMGPQIINS 255 +TPCD L E K+ D GG Y WLEEIEIP+ESEMDGIEY GPQ+ +S Sbjct: 236 DTPCDASLYGAEFRKIIDNAGGRYAWLEEIEIPEESEMDGIEYKGPQVFDS 286 >gb|KVH90534.1| Cysteamine dioxygenase [Cynara cardunculus var. scolymus] Length = 206 Score = 60.8 bits (146), Expect = 8e-09 Identities = 26/39 (66%), Positives = 34/39 (87%) Frame = -3 Query: 377 NEELTKVKDLGGCYRWLEEIEIPKESEMDGIEYMGPQII 261 +E++T ++ G CYRWLEEIE+PKES+MD IEY+GPQII Sbjct: 164 DEQMTMPEEDGKCYRWLEEIEMPKESKMDRIEYLGPQII 202 >ref|XP_002325431.2| hypothetical protein POPTR_0019s05510g [Populus trichocarpa] gi|550316870|gb|EEE99812.2| hypothetical protein POPTR_0019s05510g [Populus trichocarpa] Length = 236 Score = 57.4 bits (137), Expect = 2e-07 Identities = 24/43 (55%), Positives = 31/43 (72%) Frame = -3 Query: 383 LDNEELTKVKDLGGCYRWLEEIEIPKESEMDGIEYMGPQIINS 255 L N E+ K+ G CY WLEE E+P+ S+MDGIEY+GPQ+ S Sbjct: 192 LSNGEMELKKEEGSCYAWLEETEVPENSKMDGIEYLGPQVDES 234 >ref|XP_011001703.1| PREDICTED: 2-aminoethanethiol dioxygenase-like [Populus euphratica] Length = 280 Score = 56.2 bits (134), Expect = 7e-07 Identities = 23/41 (56%), Positives = 31/41 (75%) Frame = -3 Query: 377 NEELTKVKDLGGCYRWLEEIEIPKESEMDGIEYMGPQIINS 255 N E+ K+ G CY WLEE E+P+ S+MDGIEY+GPQ+ +S Sbjct: 238 NGEMELKKEEGSCYAWLEETEVPENSKMDGIEYLGPQVDDS 278 >gb|KVI00028.1| Cysteamine dioxygenase [Cynara cardunculus var. scolymus] Length = 193 Score = 55.1 bits (131), Expect = 1e-06 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = -3 Query: 338 YRWLEEIEIPKESEMDGIEYMGPQIINSTS 249 Y WLEEIE+PKESEM+GIEYMGPQII +S Sbjct: 163 YWWLEEIEVPKESEMEGIEYMGPQIIEMSS 192 >gb|EEF36683.1| conserved hypothetical protein [Ricinus communis] Length = 251 Score = 55.5 bits (132), Expect = 1e-06 Identities = 24/48 (50%), Positives = 33/48 (68%) Frame = -3 Query: 398 PCDVLLDNEELTKVKDLGGCYRWLEEIEIPKESEMDGIEYMGPQIINS 255 PC + N E+ ++ G Y WLEEIE+P+ S+MDGI Y+GPQI+ S Sbjct: 203 PCSAI-SNGEMKLTEEEGNSYGWLEEIEMPENSQMDGIRYLGPQIVES 249 >ref|XP_004493204.1| PREDICTED: plant cysteine oxidase 2-like [Cicer arietinum] Length = 286 Score = 55.1 bits (131), Expect = 2e-06 Identities = 24/45 (53%), Positives = 30/45 (66%) Frame = -3 Query: 398 PCDVLLDNEELTKVKDLGGCYRWLEEIEIPKESEMDGIEYMGPQI 264 PCD + EE+ KV D Y LEEIE+P+ +MDGIEY+GP I Sbjct: 237 PCDAFPNEEEIAKVNDKNDSYALLEEIEMPENCQMDGIEYLGPPI 281 >ref|XP_010530540.1| PREDICTED: probable 2-aminoethanethiol dioxygenase [Tarenaya hassleriana] Length = 294 Score = 55.1 bits (131), Expect = 2e-06 Identities = 25/52 (48%), Positives = 36/52 (69%) Frame = -3 Query: 404 ETPCDVLLDNEELTKVKDLGGCYRWLEEIEIPKESEMDGIEYMGPQIINSTS 249 E P D + D EE Y WL+EIE+P++S+MDGIEY+GPQ+I+S++ Sbjct: 246 ELPHDAVTDEEEKES-------YGWLQEIEVPEDSQMDGIEYLGPQVIDSST 290 >ref|XP_012070402.1| PREDICTED: 2-aminoethanethiol dioxygenase-like [Jatropha curcas] gi|643732565|gb|KDP39661.1| hypothetical protein JCGZ_02681 [Jatropha curcas] Length = 283 Score = 54.3 bits (129), Expect = 4e-06 Identities = 23/46 (50%), Positives = 31/46 (67%) Frame = -3 Query: 398 PCDVLLDNEELTKVKDLGGCYRWLEEIEIPKESEMDGIEYMGPQII 261 P D D EE K+ G Y WL+EI++P+ S MDGIEY+GPQ++ Sbjct: 234 PYDAFPDGEEREVKKEDGDIYGWLQEIDMPENSRMDGIEYLGPQVV 279 >ref|XP_004489672.1| PREDICTED: plant cysteine oxidase 2-like [Cicer arietinum] Length = 293 Score = 53.9 bits (128), Expect = 5e-06 Identities = 23/41 (56%), Positives = 31/41 (75%) Frame = -3 Query: 377 NEELTKVKDLGGCYRWLEEIEIPKESEMDGIEYMGPQIINS 255 N E+ ++K+ Y WLEEIE+P+ S+MDGIEY+GP II S Sbjct: 251 NGEIAELKEENESYAWLEEIEMPENSQMDGIEYLGPPIIES 291 >ref|XP_013451540.1| 2-aminoethanethiol dioxygenase-like protein [Medicago truncatula] gi|657381597|gb|KEH25568.1| 2-aminoethanethiol dioxygenase-like protein [Medicago truncatula] Length = 203 Score = 52.8 bits (125), Expect = 8e-06 Identities = 22/42 (52%), Positives = 32/42 (76%) Frame = -3 Query: 377 NEELTKVKDLGGCYRWLEEIEIPKESEMDGIEYMGPQIINST 252 N E+ ++K+ Y WLEEIE+P+ S+MDGIEY+GP II ++ Sbjct: 161 NGEIAELKEENESYGWLEEIEMPENSQMDGIEYLGPPIIETS 202 >ref|XP_010677795.1| PREDICTED: probable 2-aminoethanethiol dioxygenase [Beta vulgaris subsp. vulgaris] gi|870859923|gb|KMT11293.1| hypothetical protein BVRB_5g109770 [Beta vulgaris subsp. vulgaris] Length = 277 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/43 (53%), Positives = 33/43 (76%) Frame = -3 Query: 377 NEELTKVKDLGGCYRWLEEIEIPKESEMDGIEYMGPQIINSTS 249 +EE ++KD Y WLEEIE+P+ S+MDGIEY+GP+II + + Sbjct: 234 DEEFEELKDDEHSYGWLEEIEMPENSKMDGIEYLGPRIIETAA 276 >ref|XP_006600234.1| PREDICTED: uncharacterized protein LOC100819405 isoform X1 [Glycine max] gi|947055339|gb|KRH04792.1| hypothetical protein GLYMA_17G187300 [Glycine max] Length = 299 Score = 53.1 bits (126), Expect = 1e-05 Identities = 24/41 (58%), Positives = 30/41 (73%) Frame = -3 Query: 377 NEELTKVKDLGGCYRWLEEIEIPKESEMDGIEYMGPQIINS 255 N E KVK+ Y WLEEIE+P+ S+MDGIEY+GP II + Sbjct: 257 NGESGKVKEENDSYGWLEEIEMPENSQMDGIEYLGPPIIET 297