BLASTX nr result
ID: Rehmannia28_contig00043675
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00043675 (460 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KHN38877.1| Mechanosensitive ion channel protein 2, chloropla... 59 1e-07 ref|XP_003533418.1| PREDICTED: mechanosensitive ion channel prot... 59 1e-07 ref|XP_010938976.1| PREDICTED: mechanosensitive ion channel prot... 59 2e-07 gb|KYP66340.1| MscS family inner membrane protein ynaI [Cajanus ... 59 2e-07 ref|XP_008808855.1| PREDICTED: mechanosensitive ion channel prot... 59 2e-07 ref|XP_015890594.1| PREDICTED: mechanosensitive ion channel prot... 59 2e-07 ref|XP_010938975.1| PREDICTED: mechanosensitive ion channel prot... 59 2e-07 ref|XP_015963357.1| PREDICTED: mechanosensitive ion channel prot... 59 2e-07 gb|KRH74490.1| hypothetical protein GLYMA_01G023200 [Glycine max] 59 2e-07 ref|XP_010938974.1| PREDICTED: mechanosensitive ion channel prot... 59 2e-07 ref|XP_006573003.1| PREDICTED: mechanosensitive ion channel prot... 59 2e-07 ref|XP_014520804.1| PREDICTED: mechanosensitive ion channel prot... 59 2e-07 gb|KHN14509.1| Mechanosensitive ion channel protein 2, chloropla... 59 2e-07 ref|XP_006573000.1| PREDICTED: mechanosensitive ion channel prot... 59 2e-07 ref|XP_015890591.1| PREDICTED: mechanosensitive ion channel prot... 59 2e-07 gb|EPS67304.1| hypothetical protein M569_07470, partial [Genlise... 59 3e-07 ref|XP_006383812.1| hypothetical protein POPTR_0005s28410g [Popu... 59 3e-07 ref|XP_011016936.1| PREDICTED: mechanosensitive ion channel prot... 59 3e-07 gb|KOM26529.1| hypothetical protein LR48_Vigan284s001500 [Vigna ... 59 3e-07 ref|XP_002302344.2| hypothetical protein POPTR_0002s10610g [Popu... 59 3e-07 >gb|KHN38877.1| Mechanosensitive ion channel protein 2, chloroplastic [Glycine soja] Length = 673 Score = 59.3 bits (142), Expect = 1e-07 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = -3 Query: 458 PENQALLILVSCFVKTSHFEEYLCVKVRVL 369 PENQALLILVSCFVKTSHFEEYLCVK VL Sbjct: 359 PENQALLILVSCFVKTSHFEEYLCVKEAVL 388 >ref|XP_003533418.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like [Glycine max] gi|571478465|ref|XP_006587572.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like [Glycine max] gi|955341996|ref|XP_014617783.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like [Glycine max] gi|955341999|ref|XP_014617784.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like [Glycine max] gi|947090785|gb|KRH39450.1| hypothetical protein GLYMA_09G199100 [Glycine max] gi|947090786|gb|KRH39451.1| hypothetical protein GLYMA_09G199100 [Glycine max] gi|947090787|gb|KRH39452.1| hypothetical protein GLYMA_09G199100 [Glycine max] Length = 719 Score = 59.3 bits (142), Expect = 1e-07 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = -3 Query: 458 PENQALLILVSCFVKTSHFEEYLCVKVRVL 369 PENQALLILVSCFVKTSHFEEYLCVK VL Sbjct: 405 PENQALLILVSCFVKTSHFEEYLCVKEAVL 434 >ref|XP_010938976.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like isoform X3 [Elaeis guineensis] Length = 549 Score = 58.9 bits (141), Expect = 2e-07 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -3 Query: 458 PENQALLILVSCFVKTSHFEEYLCVKVRVL 369 PENQALLIL+SCFVKTSHFEEYLCVK VL Sbjct: 267 PENQALLILISCFVKTSHFEEYLCVKEAVL 296 >gb|KYP66340.1| MscS family inner membrane protein ynaI [Cajanus cajan] Length = 662 Score = 58.9 bits (141), Expect = 2e-07 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -3 Query: 458 PENQALLILVSCFVKTSHFEEYLCVKVRVL 369 PENQALLILVSCFVKTSHFEEYLCVK +L Sbjct: 407 PENQALLILVSCFVKTSHFEEYLCVKEAIL 436 >ref|XP_008808855.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like [Phoenix dactylifera] Length = 662 Score = 58.9 bits (141), Expect = 2e-07 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -3 Query: 458 PENQALLILVSCFVKTSHFEEYLCVKVRVL 369 PENQALLIL+SCFVKTSHFEEYLCVK VL Sbjct: 379 PENQALLILISCFVKTSHFEEYLCVKEAVL 408 >ref|XP_015890594.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic isoform X2 [Ziziphus jujuba] Length = 664 Score = 58.9 bits (141), Expect = 2e-07 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -3 Query: 458 PENQALLILVSCFVKTSHFEEYLCVKVRVL 369 PENQALLILVSCFVKTSHFEEYLCVK +L Sbjct: 335 PENQALLILVSCFVKTSHFEEYLCVKEAIL 364 >ref|XP_010938975.1| PREDICTED: mechanosensitive ion channel protein 3, chloroplastic-like isoform X2 [Elaeis guineensis] Length = 686 Score = 58.9 bits (141), Expect = 2e-07 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -3 Query: 458 PENQALLILVSCFVKTSHFEEYLCVKVRVL 369 PENQALLIL+SCFVKTSHFEEYLCVK VL Sbjct: 404 PENQALLILISCFVKTSHFEEYLCVKEAVL 433 >ref|XP_015963357.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic [Arachis duranensis] gi|1012124855|ref|XP_015963358.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic [Arachis duranensis] Length = 688 Score = 58.9 bits (141), Expect = 2e-07 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -3 Query: 458 PENQALLILVSCFVKTSHFEEYLCVKVRVL 369 PENQALLILVSCFVKTSHFEEYLCVK +L Sbjct: 407 PENQALLILVSCFVKTSHFEEYLCVKEAIL 436 >gb|KRH74490.1| hypothetical protein GLYMA_01G023200 [Glycine max] Length = 692 Score = 58.9 bits (141), Expect = 2e-07 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -3 Query: 458 PENQALLILVSCFVKTSHFEEYLCVKVRVL 369 PENQALLILVSCFVKTSHFEEYLCVK +L Sbjct: 380 PENQALLILVSCFVKTSHFEEYLCVKEAIL 409 >ref|XP_010938974.1| PREDICTED: mechanosensitive ion channel protein 3, chloroplastic-like isoform X1 [Elaeis guineensis] Length = 694 Score = 58.9 bits (141), Expect = 2e-07 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -3 Query: 458 PENQALLILVSCFVKTSHFEEYLCVKVRVL 369 PENQALLIL+SCFVKTSHFEEYLCVK VL Sbjct: 412 PENQALLILISCFVKTSHFEEYLCVKEAVL 441 >ref|XP_006573003.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like isoform X2 [Glycine max] gi|947126635|gb|KRH74489.1| hypothetical protein GLYMA_01G023200 [Glycine max] Length = 699 Score = 58.9 bits (141), Expect = 2e-07 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -3 Query: 458 PENQALLILVSCFVKTSHFEEYLCVKVRVL 369 PENQALLILVSCFVKTSHFEEYLCVK +L Sbjct: 387 PENQALLILVSCFVKTSHFEEYLCVKEAIL 416 >ref|XP_014520804.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic [Vigna radiata var. radiata] gi|951052799|ref|XP_014520806.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic [Vigna radiata var. radiata] Length = 701 Score = 58.9 bits (141), Expect = 2e-07 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -3 Query: 458 PENQALLILVSCFVKTSHFEEYLCVKVRVL 369 PENQALLILVSCFVKTSHFEEYLCVK +L Sbjct: 407 PENQALLILVSCFVKTSHFEEYLCVKEAIL 436 >gb|KHN14509.1| Mechanosensitive ion channel protein 2, chloroplastic [Glycine soja] Length = 719 Score = 58.9 bits (141), Expect = 2e-07 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -3 Query: 458 PENQALLILVSCFVKTSHFEEYLCVKVRVL 369 PENQALLILVSCFVKTSHFEEYLCVK +L Sbjct: 407 PENQALLILVSCFVKTSHFEEYLCVKEAIL 436 >ref|XP_006573000.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like isoform X1 [Glycine max] gi|571433772|ref|XP_006573001.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like isoform X1 [Glycine max] gi|571433774|ref|XP_006573002.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like isoform X1 [Glycine max] gi|947126634|gb|KRH74488.1| hypothetical protein GLYMA_01G023200 [Glycine max] Length = 719 Score = 58.9 bits (141), Expect = 2e-07 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -3 Query: 458 PENQALLILVSCFVKTSHFEEYLCVKVRVL 369 PENQALLILVSCFVKTSHFEEYLCVK +L Sbjct: 407 PENQALLILVSCFVKTSHFEEYLCVKEAIL 436 >ref|XP_015890591.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic isoform X1 [Ziziphus jujuba] gi|1009145903|ref|XP_015890592.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic isoform X1 [Ziziphus jujuba] gi|1009145905|ref|XP_015890593.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic isoform X1 [Ziziphus jujuba] Length = 738 Score = 58.9 bits (141), Expect = 2e-07 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -3 Query: 458 PENQALLILVSCFVKTSHFEEYLCVKVRVL 369 PENQALLILVSCFVKTSHFEEYLCVK +L Sbjct: 409 PENQALLILVSCFVKTSHFEEYLCVKEAIL 438 >gb|EPS67304.1| hypothetical protein M569_07470, partial [Genlisea aurea] Length = 459 Score = 58.5 bits (140), Expect = 3e-07 Identities = 31/56 (55%), Positives = 38/56 (67%), Gaps = 4/56 (7%) Frame = -3 Query: 458 PENQALLILVSCFVKTSHFEEYLCVKVRVL--FFAILLHLHKDMVGMISIL--VYS 303 PENQAL+ILVSCFVKTSHFEEYLCVK +L ++ H + I ++ VYS Sbjct: 311 PENQALMILVSCFVKTSHFEEYLCVKEAILLDLLRVIRHYRARLASPIRMIQKVYS 366 >ref|XP_006383812.1| hypothetical protein POPTR_0005s28410g [Populus trichocarpa] gi|550339925|gb|ERP61609.1| hypothetical protein POPTR_0005s28410g [Populus trichocarpa] Length = 502 Score = 58.5 bits (140), Expect = 3e-07 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -3 Query: 458 PENQALLILVSCFVKTSHFEEYLCVKVRVL 369 PENQAL+ILVSCFVKTSHFEEYLCVK VL Sbjct: 276 PENQALMILVSCFVKTSHFEEYLCVKEAVL 305 >ref|XP_011016936.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like isoform X2 [Populus euphratica] Length = 579 Score = 58.5 bits (140), Expect = 3e-07 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -3 Query: 458 PENQALLILVSCFVKTSHFEEYLCVKVRVL 369 PENQAL+ILVSCFVKTSHFEEYLCVK VL Sbjct: 274 PENQALMILVSCFVKTSHFEEYLCVKEAVL 303 >gb|KOM26529.1| hypothetical protein LR48_Vigan284s001500 [Vigna angularis] Length = 629 Score = 58.5 bits (140), Expect = 3e-07 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -3 Query: 458 PENQALLILVSCFVKTSHFEEYLCVKVRVL 369 PENQALLIL+SCFVKTSHFEEYLCVK +L Sbjct: 331 PENQALLILISCFVKTSHFEEYLCVKEAIL 360 >ref|XP_002302344.2| hypothetical protein POPTR_0002s10610g [Populus trichocarpa] gi|550344714|gb|EEE81617.2| hypothetical protein POPTR_0002s10610g [Populus trichocarpa] Length = 671 Score = 58.5 bits (140), Expect = 3e-07 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -3 Query: 458 PENQALLILVSCFVKTSHFEEYLCVKVRVL 369 PENQAL+ILVSCFVKTSHFEEYLCVK VL Sbjct: 403 PENQALMILVSCFVKTSHFEEYLCVKEAVL 432