BLASTX nr result
ID: Rehmannia28_contig00043570
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00043570 (547 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AKH66507.1| translation initiation factor 3-related protein, ... 55 9e-08 emb|CAM91292.1| putative eukaryotic translation initiation facto... 57 1e-07 emb|CAM91287.1| putative eukaryotic translation initiation facto... 57 1e-07 emb|CAM91279.1| putative eukaryotic translation initiation facto... 57 1e-07 emb|CAM91289.1| putative eukaryotic translation initiation facto... 57 2e-07 emb|CAM91284.1| putative eukaryotic translation initiation facto... 57 2e-07 emb|CAM91293.1| putative eukaryotic translation initiation facto... 57 2e-07 emb|CAM91290.1| putative eukaryotic translation initiation facto... 57 2e-07 emb|CAM90460.2| putative eukaryotic translation initiation facto... 57 2e-07 emb|CAM91278.1| putative eukaryotic translation initiation facto... 57 2e-07 emb|CAM91281.1| putative eukaryotic translation initiation facto... 57 2e-07 emb|CAM91291.1| putative eukaryotic translation initiation facto... 57 2e-07 emb|CAM91286.1| putative eukaryotic translation initiation facto... 57 2e-07 emb|CAM91283.1| putative eukaryotic translation initiation facto... 57 2e-07 emb|CAM91282.1| putative eukaryotic translation initiation facto... 57 2e-07 emb|CAM91277.1| putative eukaryotic translation initiation facto... 57 2e-07 emb|CAM91285.1| putative eukaryotic translation initiation facto... 57 2e-07 emb|CAM91274.1| putative eukaryotic translation initiation facto... 57 3e-07 emb|CAM91275.1| putative eukaryotic translation initiation facto... 57 3e-07 emb|CAM91280.1| putative eukaryotic translation initiation facto... 57 3e-07 >gb|AKH66507.1| translation initiation factor 3-related protein, partial [Syringa josikaea] Length = 38 Score = 55.5 bits (132), Expect = 9e-08 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = -3 Query: 80 YLNAIQTNAPHLLRYLATAFIVNKRR 3 YLNAIQTNAPHLLRYLATAFIVNKRR Sbjct: 1 YLNAIQTNAPHLLRYLATAFIVNKRR 26 >emb|CAM91292.1| putative eukaryotic translation initiation factor 3E [Melampyrum velebiticum] Length = 115 Score = 57.0 bits (136), Expect = 1e-07 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -3 Query: 92 NTCRYLNAIQTNAPHLLRYLATAFIVNKRR 3 N +YLNAIQTNAPHLLRYLATAFIVNKRR Sbjct: 53 NQDKYLNAIQTNAPHLLRYLATAFIVNKRR 82 >emb|CAM91287.1| putative eukaryotic translation initiation factor 3E [Melampyrum sp. JW_13_02_07] Length = 115 Score = 57.0 bits (136), Expect = 1e-07 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -3 Query: 92 NTCRYLNAIQTNAPHLLRYLATAFIVNKRR 3 N +YLNAIQTNAPHLLRYLATAFIVNKRR Sbjct: 52 NQDKYLNAIQTNAPHLLRYLATAFIVNKRR 81 >emb|CAM91279.1| putative eukaryotic translation initiation factor 3E [Melampyrum cristatum] Length = 115 Score = 57.0 bits (136), Expect = 1e-07 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -3 Query: 92 NTCRYLNAIQTNAPHLLRYLATAFIVNKRR 3 N +YLNAIQTNAPHLLRYLATAFIVNKRR Sbjct: 50 NQDKYLNAIQTNAPHLLRYLATAFIVNKRR 79 >emb|CAM91289.1| putative eukaryotic translation initiation factor 3E [Melampyrum sylvaticum] Length = 125 Score = 57.0 bits (136), Expect = 2e-07 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -3 Query: 92 NTCRYLNAIQTNAPHLLRYLATAFIVNKRR 3 N +YLNAIQTNAPHLLRYLATAFIVNKRR Sbjct: 63 NQDKYLNAIQTNAPHLLRYLATAFIVNKRR 92 >emb|CAM91284.1| putative eukaryotic translation initiation factor 3E [Melampyrum pratense] Length = 125 Score = 57.0 bits (136), Expect = 2e-07 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -3 Query: 92 NTCRYLNAIQTNAPHLLRYLATAFIVNKRR 3 N +YLNAIQTNAPHLLRYLATAFIVNKRR Sbjct: 61 NQDKYLNAIQTNAPHLLRYLATAFIVNKRR 90 >emb|CAM91293.1| putative eukaryotic translation initiation factor 3E [Melampyrum velebiticum] Length = 126 Score = 57.0 bits (136), Expect = 2e-07 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -3 Query: 92 NTCRYLNAIQTNAPHLLRYLATAFIVNKRR 3 N +YLNAIQTNAPHLLRYLATAFIVNKRR Sbjct: 76 NQDKYLNAIQTNAPHLLRYLATAFIVNKRR 105 >emb|CAM91290.1| putative eukaryotic translation initiation factor 3E [Melampyrum sylvaticum] Length = 126 Score = 57.0 bits (136), Expect = 2e-07 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -3 Query: 92 NTCRYLNAIQTNAPHLLRYLATAFIVNKRR 3 N +YLNAIQTNAPHLLRYLATAFIVNKRR Sbjct: 63 NQDKYLNAIQTNAPHLLRYLATAFIVNKRR 92 >emb|CAM90460.2| putative eukaryotic translation initiation factor 3E [Melampyrum sp. JW_13_02_07] Length = 126 Score = 57.0 bits (136), Expect = 2e-07 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -3 Query: 92 NTCRYLNAIQTNAPHLLRYLATAFIVNKRR 3 N +YLNAIQTNAPHLLRYLATAFIVNKRR Sbjct: 76 NQDKYLNAIQTNAPHLLRYLATAFIVNKRR 105 >emb|CAM91278.1| putative eukaryotic translation initiation factor 3E [Melampyrum cristatum] Length = 127 Score = 57.0 bits (136), Expect = 2e-07 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -3 Query: 92 NTCRYLNAIQTNAPHLLRYLATAFIVNKRR 3 N +YLNAIQTNAPHLLRYLATAFIVNKRR Sbjct: 63 NQDKYLNAIQTNAPHLLRYLATAFIVNKRR 92 >emb|CAM91281.1| putative eukaryotic translation initiation factor 3E [Melampyrum italicum] Length = 128 Score = 57.0 bits (136), Expect = 2e-07 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -3 Query: 92 NTCRYLNAIQTNAPHLLRYLATAFIVNKRR 3 N +YLNAIQTNAPHLLRYLATAFIVNKRR Sbjct: 63 NQDKYLNAIQTNAPHLLRYLATAFIVNKRR 92 >emb|CAM91291.1| putative eukaryotic translation initiation factor 3E [Melampyrum velebiticum] Length = 131 Score = 57.0 bits (136), Expect = 2e-07 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -3 Query: 92 NTCRYLNAIQTNAPHLLRYLATAFIVNKRR 3 N +YLNAIQTNAPHLLRYLATAFIVNKRR Sbjct: 81 NQDKYLNAIQTNAPHLLRYLATAFIVNKRR 110 >emb|CAM91286.1| putative eukaryotic translation initiation factor 3E [Melampyrum sp. JW_13_02_07] Length = 133 Score = 57.0 bits (136), Expect = 2e-07 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -3 Query: 92 NTCRYLNAIQTNAPHLLRYLATAFIVNKRR 3 N +YLNAIQTNAPHLLRYLATAFIVNKRR Sbjct: 81 NQDKYLNAIQTNAPHLLRYLATAFIVNKRR 110 >emb|CAM91283.1| putative eukaryotic translation initiation factor 3E [Melampyrum pratense] Length = 136 Score = 57.0 bits (136), Expect = 2e-07 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -3 Query: 92 NTCRYLNAIQTNAPHLLRYLATAFIVNKRR 3 N +YLNAIQTNAPHLLRYLATAFIVNKRR Sbjct: 78 NQDKYLNAIQTNAPHLLRYLATAFIVNKRR 107 >emb|CAM91282.1| putative eukaryotic translation initiation factor 3E [Melampyrum italicum] Length = 138 Score = 57.0 bits (136), Expect = 2e-07 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -3 Query: 92 NTCRYLNAIQTNAPHLLRYLATAFIVNKRR 3 N +YLNAIQTNAPHLLRYLATAFIVNKRR Sbjct: 83 NQDKYLNAIQTNAPHLLRYLATAFIVNKRR 112 >emb|CAM91277.1| putative eukaryotic translation initiation factor 3E [Melampyrum cristatum] Length = 138 Score = 57.0 bits (136), Expect = 2e-07 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -3 Query: 92 NTCRYLNAIQTNAPHLLRYLATAFIVNKRR 3 N +YLNAIQTNAPHLLRYLATAFIVNKRR Sbjct: 83 NQDKYLNAIQTNAPHLLRYLATAFIVNKRR 112 >emb|CAM91285.1| putative eukaryotic translation initiation factor 3E [Melampyrum pratense] Length = 141 Score = 57.0 bits (136), Expect = 2e-07 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -3 Query: 92 NTCRYLNAIQTNAPHLLRYLATAFIVNKRR 3 N +YLNAIQTNAPHLLRYLATAFIVNKRR Sbjct: 76 NQDKYLNAIQTNAPHLLRYLATAFIVNKRR 105 >emb|CAM91274.1| putative eukaryotic translation initiation factor 3E [Melampyrum arvense] Length = 142 Score = 57.0 bits (136), Expect = 3e-07 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -3 Query: 92 NTCRYLNAIQTNAPHLLRYLATAFIVNKRR 3 N +YLNAIQTNAPHLLRYLATAFIVNKRR Sbjct: 77 NQDKYLNAIQTNAPHLLRYLATAFIVNKRR 106 >emb|CAM91275.1| putative eukaryotic translation initiation factor 3E [Melampyrum arvense] Length = 147 Score = 57.0 bits (136), Expect = 3e-07 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -3 Query: 92 NTCRYLNAIQTNAPHLLRYLATAFIVNKRR 3 N +YLNAIQTNAPHLLRYLATAFIVNKRR Sbjct: 80 NQDKYLNAIQTNAPHLLRYLATAFIVNKRR 109 >emb|CAM91280.1| putative eukaryotic translation initiation factor 3E [Melampyrum italicum] Length = 149 Score = 57.0 bits (136), Expect = 3e-07 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -3 Query: 92 NTCRYLNAIQTNAPHLLRYLATAFIVNKRR 3 N +YLNAIQTNAPHLLRYLATAFIVNKRR Sbjct: 86 NQDKYLNAIQTNAPHLLRYLATAFIVNKRR 115