BLASTX nr result
ID: Rehmannia28_contig00042170
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00042170 (483 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN75728.1| hypothetical protein VITISV_031408 [Vitis vinifera] 80 2e-14 emb|CAN78509.1| hypothetical protein VITISV_031642 [Vitis vinifera] 76 3e-13 gb|KYP34577.1| Retrovirus-related Pol polyprotein from transposo... 71 1e-11 gb|KYP34572.1| Retrovirus-related Pol polyprotein from transposo... 71 1e-11 gb|KYP40443.1| Retrovirus-related Pol polyprotein from transposo... 70 2e-11 gb|KYP65286.1| Retrovirus-related Pol polyprotein from transposo... 70 3e-11 gb|KYP38387.1| Retrovirus-related Pol polyprotein from transposo... 70 3e-11 gb|KYP64199.1| Retrovirus-related Pol polyprotein from transposo... 70 4e-11 gb|KYP53274.1| Retrovirus-related Pol polyprotein from transposo... 70 5e-11 gb|KYP51497.1| Retrovirus-related Pol polyprotein from transposo... 69 7e-11 gb|KYP75335.1| Retrovirus-related Pol polyprotein from transposo... 69 1e-10 emb|CAN83839.1| hypothetical protein VITISV_023230 [Vitis vinifera] 69 1e-10 gb|KYP75416.1| Retrovirus-related Pol polyprotein from transposo... 68 2e-10 gb|KYP43795.1| Retrovirus-related Pol polyprotein from transposo... 68 2e-10 gb|KYP47787.1| Retrovirus-related Pol polyprotein from transposo... 68 2e-10 ref|XP_015386863.1| PREDICTED: uncharacterized protein LOC107177... 68 2e-10 gb|KYP67039.1| Retrovirus-related Pol polyprotein from transposo... 68 2e-10 gb|KYP61342.1| Retrovirus-related Pol polyprotein from transposo... 68 2e-10 gb|KYP70184.1| Retrovirus-related Pol polyprotein from transposo... 66 3e-10 ref|XP_015934891.1| PREDICTED: uncharacterized protein LOC107460... 67 4e-10 >emb|CAN75728.1| hypothetical protein VITISV_031408 [Vitis vinifera] Length = 1099 Score = 79.7 bits (195), Expect = 2e-14 Identities = 33/41 (80%), Positives = 39/41 (95%) Frame = -1 Query: 480 RSTKCVFLGYSPAHKGYRCLSPSGRIYVARTVTFNENEFPY 358 RSTKC+FLGYSP HKGYRCLS SG+IYVA+++TFNEN+FPY Sbjct: 492 RSTKCLFLGYSPXHKGYRCLSXSGQIYVAKSITFNENDFPY 532 >emb|CAN78509.1| hypothetical protein VITISV_031642 [Vitis vinifera] Length = 722 Score = 75.9 bits (185), Expect = 3e-13 Identities = 32/41 (78%), Positives = 36/41 (87%) Frame = -1 Query: 480 RSTKCVFLGYSPAHKGYRCLSPSGRIYVARTVTFNENEFPY 358 +STKC+FLGYSPAH GYRC S S RIYVA+ VTFNEN+FPY Sbjct: 518 KSTKCLFLGYSPAHNGYRCFSSSNRIYVAKLVTFNENDFPY 558 >gb|KYP34577.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94, partial [Cajanus cajan] Length = 661 Score = 71.2 bits (173), Expect = 1e-11 Identities = 29/43 (67%), Positives = 37/43 (86%) Frame = -1 Query: 480 RSTKCVFLGYSPAHKGYRCLSPSGRIYVARTVTFNENEFPYPS 352 RS +CVFLGYS +HKGY+CL+PSGRI++++ V F EN FPYPS Sbjct: 360 RSQECVFLGYSTSHKGYKCLAPSGRIFISKDVIFCENHFPYPS 402 >gb|KYP34572.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cajanus cajan] Length = 682 Score = 71.2 bits (173), Expect = 1e-11 Identities = 29/43 (67%), Positives = 37/43 (86%) Frame = -1 Query: 480 RSTKCVFLGYSPAHKGYRCLSPSGRIYVARTVTFNENEFPYPS 352 RS +CVFLGYS +HKGY+CL+PSGRI++++ V F EN FPYPS Sbjct: 381 RSQECVFLGYSTSHKGYKCLAPSGRIFISKDVIFCENHFPYPS 423 >gb|KYP40443.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94, partial [Cajanus cajan] Length = 488 Score = 70.5 bits (171), Expect = 2e-11 Identities = 29/41 (70%), Positives = 35/41 (85%) Frame = -1 Query: 480 RSTKCVFLGYSPAHKGYRCLSPSGRIYVARTVTFNENEFPY 358 RS +CVFLGYSP+HKGY+CLS SGRIY+++ V FNE FPY Sbjct: 244 RSEECVFLGYSPSHKGYKCLSRSGRIYISKDVIFNEGRFPY 284 >gb|KYP65286.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94, partial [Cajanus cajan] Length = 904 Score = 70.5 bits (171), Expect = 3e-11 Identities = 29/41 (70%), Positives = 35/41 (85%) Frame = -1 Query: 480 RSTKCVFLGYSPAHKGYRCLSPSGRIYVARTVTFNENEFPY 358 RS +CVFLGYSP+HKGY+CLS SGRIY+++ V FNE FPY Sbjct: 713 RSEECVFLGYSPSHKGYKCLSRSGRIYISKDVIFNEGRFPY 753 >gb|KYP38387.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cajanus cajan] Length = 600 Score = 70.1 bits (170), Expect = 3e-11 Identities = 28/41 (68%), Positives = 35/41 (85%) Frame = -1 Query: 480 RSTKCVFLGYSPAHKGYRCLSPSGRIYVARTVTFNENEFPY 358 RS +C+FLGYSP HKGY+CLS SGRIY+++ V FNE+ FPY Sbjct: 375 RSEECLFLGYSPTHKGYKCLSKSGRIYISKDVVFNESRFPY 415 >gb|KYP64199.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cajanus cajan] Length = 1408 Score = 70.1 bits (170), Expect = 4e-11 Identities = 29/41 (70%), Positives = 34/41 (82%) Frame = -1 Query: 480 RSTKCVFLGYSPAHKGYRCLSPSGRIYVARTVTFNENEFPY 358 RS +CVFLGYSP HKGY+CLS SGRIY+++ V FNE FPY Sbjct: 746 RSEECVFLGYSPLHKGYKCLSKSGRIYISKDVIFNEGRFPY 786 >gb|KYP53274.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cajanus cajan] Length = 839 Score = 69.7 bits (169), Expect = 5e-11 Identities = 27/43 (62%), Positives = 37/43 (86%) Frame = -1 Query: 480 RSTKCVFLGYSPAHKGYRCLSPSGRIYVARTVTFNENEFPYPS 352 RS +CVFLGYS +HKGY+CL+PSGR+++++ V F EN FPYP+ Sbjct: 395 RSQECVFLGYSTSHKGYKCLAPSGRVFISKDVIFCENRFPYPT 437 >gb|KYP51497.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cajanus cajan] Length = 872 Score = 69.3 bits (168), Expect = 7e-11 Identities = 28/41 (68%), Positives = 35/41 (85%) Frame = -1 Query: 480 RSTKCVFLGYSPAHKGYRCLSPSGRIYVARTVTFNENEFPY 358 RS +C+FLGYSP+HKGY+CLS SGRIY+++ V FNE FPY Sbjct: 375 RSEECLFLGYSPSHKGYKCLSRSGRIYISKDVIFNEGRFPY 415 >gb|KYP75335.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cajanus cajan] Length = 537 Score = 68.6 bits (166), Expect = 1e-10 Identities = 27/44 (61%), Positives = 37/44 (84%) Frame = -1 Query: 483 IRSTKCVFLGYSPAHKGYRCLSPSGRIYVARTVTFNENEFPYPS 352 +RS +CVFLGYS +HKGY+CL+P+GRI++++ V F E FPYPS Sbjct: 283 LRSQECVFLGYSTSHKGYKCLAPTGRIFISKDVIFCETRFPYPS 326 >emb|CAN83839.1| hypothetical protein VITISV_023230 [Vitis vinifera] Length = 731 Score = 68.6 bits (166), Expect = 1e-10 Identities = 28/41 (68%), Positives = 34/41 (82%) Frame = -1 Query: 480 RSTKCVFLGYSPAHKGYRCLSPSGRIYVARTVTFNENEFPY 358 RS+KC+FLGYS HKGY CL P G+IY++R V FNE+EFPY Sbjct: 114 RSSKCLFLGYSSTHKGYLCLHPFGKIYISRNVIFNEHEFPY 154 >gb|KYP75416.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94, partial [Cajanus cajan] Length = 785 Score = 68.2 bits (165), Expect = 2e-10 Identities = 27/43 (62%), Positives = 36/43 (83%) Frame = -1 Query: 480 RSTKCVFLGYSPAHKGYRCLSPSGRIYVARTVTFNENEFPYPS 352 RS +CVFLGYS +HKGY+CL+P+GRI++++ V F E FPYPS Sbjct: 648 RSQECVFLGYSTSHKGYKCLAPTGRIFISKDVVFCETRFPYPS 690 >gb|KYP43795.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cajanus cajan] Length = 974 Score = 68.2 bits (165), Expect = 2e-10 Identities = 28/41 (68%), Positives = 34/41 (82%) Frame = -1 Query: 480 RSTKCVFLGYSPAHKGYRCLSPSGRIYVARTVTFNENEFPY 358 RS +C+FLGYSP HKGY+CLS SGRIY+++ V FNE FPY Sbjct: 745 RSEECLFLGYSPNHKGYKCLSRSGRIYISKDVIFNEGRFPY 785 >gb|KYP47787.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cajanus cajan] Length = 1299 Score = 68.2 bits (165), Expect = 2e-10 Identities = 28/41 (68%), Positives = 34/41 (82%) Frame = -1 Query: 480 RSTKCVFLGYSPAHKGYRCLSPSGRIYVARTVTFNENEFPY 358 RS +C+FLGYS HKGY+CLS SGRIY+++ V FNEN FPY Sbjct: 794 RSEECLFLGYSLTHKGYKCLSKSGRIYISKDVVFNENRFPY 834 >ref|XP_015386863.1| PREDICTED: uncharacterized protein LOC107177515 [Citrus sinensis] Length = 1143 Score = 67.8 bits (164), Expect = 2e-10 Identities = 28/42 (66%), Positives = 34/42 (80%) Frame = -1 Query: 477 STKCVFLGYSPAHKGYRCLSPSGRIYVARTVTFNENEFPYPS 352 ++KCVFLGYSP HKGY+CL PSGR Y+A V F+E+ FPY S Sbjct: 784 TSKCVFLGYSPLHKGYKCLHPSGRTYIASHVLFDESSFPYSS 825 >gb|KYP67039.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cajanus cajan] Length = 1279 Score = 67.8 bits (164), Expect = 2e-10 Identities = 28/41 (68%), Positives = 35/41 (85%) Frame = -1 Query: 480 RSTKCVFLGYSPAHKGYRCLSPSGRIYVARTVTFNENEFPY 358 RS +CVFLGYS +HKGY+CLS SGRIY+++ V FNE+ FPY Sbjct: 607 RSQECVFLGYSNSHKGYKCLSSSGRIYISKDVIFNEHRFPY 647 >gb|KYP61342.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cajanus cajan] Length = 1358 Score = 67.8 bits (164), Expect = 2e-10 Identities = 28/41 (68%), Positives = 35/41 (85%) Frame = -1 Query: 480 RSTKCVFLGYSPAHKGYRCLSPSGRIYVARTVTFNENEFPY 358 RS +CVFLGYS +HKGY+CLS SGRIY+++ V FNE+ FPY Sbjct: 686 RSQECVFLGYSNSHKGYKCLSSSGRIYISKDVIFNEHRFPY 726 >gb|KYP70184.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94, partial [Cajanus cajan] Length = 243 Score = 66.2 bits (160), Expect = 3e-10 Identities = 27/41 (65%), Positives = 34/41 (82%) Frame = -1 Query: 480 RSTKCVFLGYSPAHKGYRCLSPSGRIYVARTVTFNENEFPY 358 RS +CVFLGYS +HKGY+CLS SG+IY+++ V FNE FPY Sbjct: 87 RSQECVFLGYSNSHKGYKCLSASGKIYISKDVIFNETRFPY 127 >ref|XP_015934891.1| PREDICTED: uncharacterized protein LOC107460974 [Arachis duranensis] Length = 873 Score = 67.0 bits (162), Expect = 4e-10 Identities = 28/43 (65%), Positives = 35/43 (81%) Frame = -1 Query: 480 RSTKCVFLGYSPAHKGYRCLSPSGRIYVARTVTFNENEFPYPS 352 ++ KC+FLGYSP HKGY+CL PS + YVAR V F+E+EFPY S Sbjct: 499 KTHKCLFLGYSPYHKGYKCLCPSEKFYVARHVVFDESEFPYQS 541