BLASTX nr result
ID: Rehmannia28_contig00041444
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00041444 (609 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011102319.1| PREDICTED: uncharacterized protein LOC105180... 58 5e-07 ref|XP_012843310.1| PREDICTED: uncharacterized protein LOC105963... 55 3e-06 >ref|XP_011102319.1| PREDICTED: uncharacterized protein LOC105180362 [Sesamum indicum] Length = 202 Score = 57.8 bits (138), Expect = 5e-07 Identities = 31/42 (73%), Positives = 33/42 (78%), Gaps = 1/42 (2%) Frame = +1 Query: 178 EVVSSAGCFPSPLAKLKNAKKR-NGDPRSGHEPEYYSDLDTP 300 +VVSS GCFP+PLAK KNAKK N RS EPEYYSDLDTP Sbjct: 122 DVVSSVGCFPTPLAKRKNAKKSVNAVSRS--EPEYYSDLDTP 161 >ref|XP_012843310.1| PREDICTED: uncharacterized protein LOC105963452 [Erythranthe guttata] gi|604322094|gb|EYU32512.1| hypothetical protein MIMGU_mgv1a021487mg [Erythranthe guttata] Length = 169 Score = 55.1 bits (131), Expect = 3e-06 Identities = 27/40 (67%), Positives = 32/40 (80%) Frame = +1 Query: 178 EVVSSAGCFPSPLAKLKNAKKRNGDPRSGHEPEYYSDLDT 297 EVVSS+GC +PL K +NAKKR G+PRS +PEYYSD DT Sbjct: 92 EVVSSSGC--TPLKKRQNAKKRTGEPRSRSQPEYYSDHDT 129