BLASTX nr result
ID: Rehmannia28_contig00041047
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00041047 (458 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_015793681.1| PREDICTED: 46 kDa FK506-binding nuclear prot... 58 1e-16 >ref|XP_015793681.1| PREDICTED: 46 kDa FK506-binding nuclear protein-like [Tetranychus urticae] Length = 342 Score = 57.8 bits (138), Expect(2) = 1e-16 Identities = 31/68 (45%), Positives = 31/68 (45%) Frame = +1 Query: 220 KQGTPKAVTPXXXXXXXXXXXXXXXXXXXXXPQNNYNKNQNSGKKGTXXXXXXXXXXXXX 399 KQGTPKAVTP PQNNYNKNQNSGKKGT Sbjct: 275 KQGTPKAVTPQQNKGGFQGGKQQWSGGKNKGPQNNYNKNQNSGKKGTPGKFGGSPGNKGN 334 Query: 400 XXXWQNKK 423 WQNKK Sbjct: 335 KKPWQNKK 342 Score = 55.5 bits (132), Expect(2) = 1e-16 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 111 PEAKKPVKSQPKQQNNQKGTPAKLG 185 PEAKKPVKSQPKQQNNQKGTPAKLG Sbjct: 239 PEAKKPVKSQPKQQNNQKGTPAKLG 263