BLASTX nr result
ID: Rehmannia28_contig00040660
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00040660 (737 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU44488.1| hypothetical protein MIMGU_mgv1a016650mg [Erythra... 54 7e-06 >gb|EYU44488.1| hypothetical protein MIMGU_mgv1a016650mg [Erythranthe guttata] Length = 113 Score = 53.5 bits (127), Expect = 7e-06 Identities = 26/33 (78%), Positives = 30/33 (90%), Gaps = 1/33 (3%) Frame = -2 Query: 736 KDLLTRDYLSDHKFSVSTYSESGVVR-FVTLFF 641 KDLLT+DYLSDHKFSVSTYSESGVV+ F ++F Sbjct: 80 KDLLTKDYLSDHKFSVSTYSESGVVQIFYIIYF 112